Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Mri1 Antibody Titration: 2.5ug/mlELISA Titer: 1:1562500Positive Control: NIH/3T3 cell lysate)

Rabbit Mri1 Polyclonal Antibody | anti-MRI1 antibody

Mri1 antibody - N-terminal region

Gene Names
Mri1; 2410018C20Rik
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
Mri1; Polyclonal Antibody; Mri1 antibody - N-terminal region; anti-MRI1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LGQVAAQEAEREGATEETVRERVIRFAEDMLEKDLKDNRSIGDLGARHLL
Sequence Length
369
Applicable Applications for anti-MRI1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 79%; Horse: 86%; Human: 86%; Mouse: 100%; Pig: 93%; Rabbit: 79%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of mouse 2410018C20RIK
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Mri1 Antibody Titration: 2.5ug/mlELISA Titer: 1:1562500Positive Control: NIH/3T3 cell lysate)

Western Blot (WB) (WB Suggested Anti-Mri1 Antibody Titration: 2.5ug/mlELISA Titer: 1:1562500Positive Control: NIH/3T3 cell lysate)
Related Product Information for anti-MRI1 antibody
This is a rabbit polyclonal antibody against 2410018C20RIK. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This protein was disclosed by the RIKEN Mouse Gene Encyclopaedia Project, a systematic approach to determining the full coding potential of the mouse genome, involves collection and sequencing of full length complementary DNAs and physical mapping of the corresponding genes to the mouse genome.
Product Categories/Family for anti-MRI1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
methylthioribose-1-phosphate isomerase
NCBI Official Synonym Full Names
methylthioribose-1-phosphate isomerase 1
NCBI Official Symbol
Mri1
NCBI Official Synonym Symbols
2410018C20Rik
NCBI Protein Information
methylthioribose-1-phosphate isomerase
UniProt Protein Name
Methylthioribose-1-phosphate isomerase
UniProt Gene Name
Mri1
UniProt Synonym Gene Names
M1Pi; MTR-1-P isomerase
UniProt Entry Name
MTNA_MOUSE

Uniprot Description

MRI1: Catalyzes the interconversion of methylthioribose-1- phosphate (MTR-1-P) into methylthioribulose-1-phosphate (MTRu-1- P). Independently from catalytic activity, promotes cell invasion in response to constitutive RhoA activation by promoting FAK tyrosine phosphorylation and stress fiber turnover. Belongs to the eIF-2B alpha/beta/delta subunits family. MtnA subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 5.3.1.23; Isomerase

Cellular Component: cytoplasm; nucleolus; nucleus

Molecular Function: identical protein binding; S-methyl-5-thioribose-1-phosphate isomerase activity; isomerase activity

Biological Process: cellular biosynthetic process; cellular metabolic process; methionine salvage; methionine biosynthetic process; amino acid biosynthetic process

Similar Products

Product Notes

The MRI1 mri1 (Catalog #AAA3203558) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Mri1 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Mri1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MRI1 mri1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LGQVAAQEAE REGATEETVR ERVIRFAEDM LEKDLKDNRS IGDLGARHLL. It is sometimes possible for the material contained within the vial of "Mri1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.