Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (MPZL1 antibody (MBS839450) used at 1 ug/ml to detect target protein.)

Rabbit MPZL1 Polyclonal Antibody | anti-MPZL1 antibody

MPZL1 antibody

Gene Names
MPZL1; PZR; PZRa; PZRb; PZR1b; MPZL1b
Applications
Western Blot
Purity
Affinity purified
Synonyms
MPZL1; Polyclonal Antibody; MPZL1 antibody; Polyclonal MPZL1; Anti-MPZL1; FLJ21047; MPZL 1; PZR1b; MPZL-1; PZRb; Myelin Protein Zero-Like 1; PZR; PZRa; anti-MPZL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
MPZL1 antibody was raised against the middle region of MPZL1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MPZL1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
269
Applicable Applications for anti-MPZL1 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
MPZL1 is a cell surface receptor, which is involved in signal transduction processes. MPZL1 recruits PTPN11/SHP-2 to the cell membrane and is a putative substrate of PTPN11/SHP-2.
Cross-Reactivity
Human
Immunogen
MPZL1 antibody was raised using the middle region of MPZL1 corresponding to a region with amino acids ISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVE
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(MPZL1 antibody (MBS839450) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (MPZL1 antibody (MBS839450) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-MPZL1 antibody
Rabbit polyclonal MPZL1 antibody raised against the middle region of MPZL1
Product Categories/Family for anti-MPZL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
23 kDa (MW of target protein)
NCBI Official Full Name
MPZL1, partial
NCBI Official Synonym Full Names
myelin protein zero-like 1
NCBI Official Symbol
MPZL1
NCBI Official Synonym Symbols
PZR; PZRa; PZRb; PZR1b; MPZL1b
NCBI Protein Information
myelin protein zero-like protein 1
UniProt Protein Name
Myelin protein zero-like protein 1
UniProt Gene Name
MPZL1
UniProt Synonym Gene Names
PZR
UniProt Entry Name
MPZL1_HUMAN

Uniprot Description

PZR: an immunoglobulin superfamily cell surface protein. Contains two tyrosine-based inhibition motifs (ITIMs) responsible for binding of SHP-2. When phosphorylated, it can specifically bind SHP-2, blocking its translocation, and interupting its function. Treatment of several cell lines with ConA caused tyrosine phosphorylation of PZR. Two alternatively spliced isoforms have been reported. One isoform, PZR1b, lacks the ITIMs and has a dominant negative effect upon full-length PZR and its recruitment of SHP-2.

Protein type: Membrane protein, integral; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 1q24.2

Cellular Component: focal adhesion; cell surface; integral to plasma membrane

Molecular Function: protein binding; structural molecule activity

Biological Process: cell-cell signaling; transmembrane receptor protein tyrosine kinase signaling pathway

Research Articles on MPZL1

Similar Products

Product Notes

The MPZL1 mpzl1 (Catalog #AAA839450) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's MPZL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the MPZL1 mpzl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MPZL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.