Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of MPZL1 expression in transfected 293T cell line by MPZL1 polyclonal antibody. Lane 1: MPZL1 transfected lysate (29.1kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human PZR Polyclonal Antibody | anti-MPZL1 antibody

PZR (Myelin Protein Zero-like Protein 1, Protein Zero-related, MPZL1, UNQ849/PRO1787)

Gene Names
MPZL1; PZR; PZRa; PZRb; PZR1b; MPZL1b
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
PZR; Polyclonal Antibody; PZR (Myelin Protein Zero-like Protein 1; Protein Zero-related; MPZL1; UNQ849/PRO1787); Anti -PZR (Myelin Protein Zero-like Protein 1; anti-MPZL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MPZL1.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAASAGAGAVIAAPDSRRWLWSVLAAALGLLTAGVSALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENLPVFPVWVVVGIVTAVVLGLTLLISMILAVLYRRKNSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN
Applicable Applications for anti-MPZL1 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human MPZL1, aa1-269 (NP_003944.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MPZL1 expression in transfected 293T cell line by MPZL1 polyclonal antibody. Lane 1: MPZL1 transfected lysate (29.1kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MPZL1 expression in transfected 293T cell line by MPZL1 polyclonal antibody. Lane 1: MPZL1 transfected lysate (29.1kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-MPZL1 antibody
PZR (Protein zero related) is an immunoglobulin superfamily protein that specifically binds the tyrosine phosphatase SHP-2 through its intracellular immunoreceptor tyrosine-based inhibitory motifs (ITIMs). PZR is phosphorylated by c-Src, c-Fyn, c-Lyn, Csk, and c-Abl. PP1, a Src family kinase inhibitor, inhibits PZR phosphorylation. There are three alternatively spliced isoforms designated as PZR, PZRa, and PZRb; both PZRa and PZRb lack ITIMs. PZR is a main receptor of ConA and has an important role in cell signaling via c-Src. PZR is expressed in many cell types and is localized to cell contacts and intracellular granules in BAECs and mesothelioma (REN) cells. Recently, PZR has been implicated as a cell adhesion protein that may be involved in SHP-2-dependent signaling at interendothelial cell contacts. Hypertyrosine phosphorylation of PZR was observed during embryogenesis in a mouse model of Noonan Syndrome.
Product Categories/Family for anti-MPZL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
29,082 Da
NCBI Official Full Name
protein zero related protein
NCBI Official Synonym Full Names
myelin protein zero-like 1
NCBI Official Symbol
MPZL1
NCBI Official Synonym Symbols
PZR; PZRa; PZRb; PZR1b; MPZL1b
NCBI Protein Information
myelin protein zero-like protein 1; protein zero related; protein zero-related; immunoglobulin family transmembrane protein
UniProt Protein Name
Myelin protein zero-like protein 1
UniProt Gene Name
MPZL1
UniProt Synonym Gene Names
PZR
UniProt Entry Name
MPZL1_HUMAN

Uniprot Description

PZR: an immunoglobulin superfamily cell surface protein. Contains two tyrosine-based inhibition motifs (ITIMs) responsible for binding of SHP-2. When phosphorylated, it can specifically bind SHP-2, blocking its translocation, and interupting its function. Treatment of several cell lines with ConA caused tyrosine phosphorylation of PZR. Two alternatively spliced isoforms have been reported. One isoform, PZR1b, lacks the ITIMs and has a dominant negative effect upon full-length PZR and its recruitment of SHP-2.

Protein type: Membrane protein, integral; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 1q24.2

Cellular Component: focal adhesion; cell surface; integral to plasma membrane

Molecular Function: protein binding; structural molecule activity

Biological Process: cell-cell signaling; transmembrane receptor protein tyrosine kinase signaling pathway

Research Articles on MPZL1

Similar Products

Product Notes

The MPZL1 mpzl1 (Catalog #AAA644809) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PZR (Myelin Protein Zero-like Protein 1, Protein Zero-related, MPZL1, UNQ849/PRO1787) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PZR can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the MPZL1 mpzl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAASAGAGAV IAAPDSRRWL WSVLAAALGL LTAGVSALEV YTPKEIFVAN GTQGKLTCKF KSTSTTGGLT SVSWSFQPEG ADTTVSFFHY SQGQVYLGNY PPFKDRISWA GDLDKKDASI NIENMQFIHN GTYICDVKNP PDIVVQPGHI RLYVVEKENL PVFPVWVVVG IVTAVVLGLT LLISMILAVL YRRKNSKRDY TGCSTSESLS PVKQAPRKSP SDTEGLVKSL PSGSHQGPVI YAQLDHSGGH HSDKINKSES VVYADIRKN. It is sometimes possible for the material contained within the vial of "PZR, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.