Western Blot (WB)
(Host: RabbitTarget Name: MORC3Sample Tissue: Human HCT116 Whole CellAntibody Dilution: 1ug/ml)
Rabbit MORC3 Polyclonal Antibody | anti-MORC3 antibody
MORC3 Antibody - C-terminal region
Gene Names
MORC3; NXP2; ZCW5; ZCWCC3
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity purified
Synonyms
MORC3; Polyclonal Antibody; MORC3 Antibody - C-terminal region; anti-MORC3 antibody
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RLSSQFENSVYKGDDDDEDVIILEENSTPKPAVDHDIDMKSEQSHVEQGG
Sequence Length
939
Applicable Applications for anti-MORC3 antibody
Western Blot (WB)
Homology
Dog: 79%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Mouse: 79%; Rabbit: 79%; Rat: 79%; Yeast: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MORC3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: MORC3Sample Tissue: Human HCT116 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: MORC3Sample Tissue: Human HCT116 Whole CellAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: MORC3Sample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: MORC3Sample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-MORC3 antibody
This is a rabbit polyclonal antibody against MORC3. It was validated on Western Blot
Target Description: This gene encodes a protein that localizes to the nuclear matrix. The protein also has RNA binding activity, and has a predicted coiled-coil domain.
Target Description: This gene encodes a protein that localizes to the nuclear matrix. The protein also has RNA binding activity, and has a predicted coiled-coil domain.
Product Categories/Family for anti-MORC3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
103kDa
NCBI Official Full Name
MORC family CW-type zinc finger protein 3 isoform 1
NCBI Official Synonym Full Names
MORC family CW-type zinc finger 3
NCBI Official Symbol
MORC3
NCBI Official Synonym Symbols
NXP2; ZCW5; ZCWCC3
NCBI Protein Information
MORC family CW-type zinc finger protein 3
UniProt Protein Name
MORC family CW-type zinc finger protein 3
Protein Family
UniProt Gene Name
MORC3
UniProt Synonym Gene Names
KIAA0136; ZCWCC3
UniProt Entry Name
MORC3_HUMAN
NCBI Description
This gene encodes a protein that localizes to the nuclear matrix and forms nuclear bodies via an ATP-dependent mechanism. The protein is predicted to have coiled-coil and zinc finger domains and has RNA binding activity. Alternative splicing produces multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Feb 2016]
Research Articles on MORC3
Similar Products
Product Notes
The MORC3 morc3 (Catalog #AAA3207944) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MORC3 Antibody - C-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's MORC3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MORC3 morc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RLSSQFENSV YKGDDDDEDV IILEENSTPK PAVDHDIDMK SEQSHVEQGG. It is sometimes possible for the material contained within the vial of "MORC3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
