<
Flow Cytometry (FC/FACS)
Rabbit MORC3 Polyclonal Antibody | anti-MORC3 antibody
Anti-MORC3 Antibody
Gene Names
MORC3; NXP2; ZCW5; ZCWCC3
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Flow Cytometry, Functional Assay
Purity
Immunogen affinity purified.
Synonyms
MORC3; Polyclonal Antibody; Anti-MORC3 Antibody; MORC family CW-type zinc finger protein 3; Nuclear matrix protein 2; Zinc finger CW-type coiled-coil domain protein 3; KIAA0136; NXP2; ZCWCC3; anti-MORC3 antibody
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
939
Applicable Applications for anti-MORC3 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin, Immunocytochemistry (ICC), Immunofluorescence (IF), Flow Cytometry (FC/FACS)
Application Notes
WB: 0.25-0.5ug/ml (Mouse, Rat)
IHC-P (Embedded Section): 0.5-1ug/ml (Human)
ICC: 2ug/ml (Human)
IF: 2ug/ml (Human)
FC/FACS: 1-3ug/1x106 cells (Human)
Tested Species: In-house tested species with positive results.
IHC-P (Embedded Section): 0.5-1ug/ml (Human)
ICC: 2ug/ml (Human)
IF: 2ug/ml (Human)
FC/FACS: 1-3ug/1x106 cells (Human)
Tested Species: In-house tested species with positive results.
Immunogen
A synthetic peptide corresponding to a sequence of human MORC3 (ESLKLRSLRVNVGQLLAMIVPDLDLQQVNYDVD).
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen store at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Flow Cytometry (FC/FACS)
Flow Cytometry (FC/FACS)
Immunofluorescence (IF)
Immunofluorescence (IF)
Immunohistochemistry (IHC)
Immunohistochemistry (IHC)
Immunohistochemistry (IHC)
Immunohistochemistry (IHC)
Western Blot (WB)
(Figure 1. Western blot analysis of MORC3 using anti-MORC3 antibody.)
Western Blot (WB)
(Figure 1. Western blot analysis of MORC3 using anti-MORC3 antibody.)
Related Product Information for anti-MORC3 antibody
Description: Rabbit IgG polyclonal antibody for MORC3 detection. Tested with WB, IHC-P, ICC/IF, FCM in Human; Mouse; Rat.
Background: MORC family CW-type zinc finger protein 3 is a protein that in humans is encoded by the MORC3 gene. This gene is mapped to 21q22.12. This gene encodes a protein that localizes to the nuclear matrix and forms nuclear bodies via an ATP-dependent mechanism. The protein is predicted to have coiled-coil and zinc finger domains and has RNA binding activity. Alternative splicing produces multiple transcript variants encoding distinct isoforms.
Background: MORC family CW-type zinc finger protein 3 is a protein that in humans is encoded by the MORC3 gene. This gene is mapped to 21q22.12. This gene encodes a protein that localizes to the nuclear matrix and forms nuclear bodies via an ATP-dependent mechanism. The protein is predicted to have coiled-coil and zinc finger domains and has RNA binding activity. Alternative splicing produces multiple transcript variants encoding distinct isoforms.
References
1. Kimura, Y., Sakai, F., Nakano, O., Kisaki, O., Sugimoto, H., Sawamura, T., Sadano, H., Osumi, T. The newly identified human nuclear protein NXP-2 possesses three distinct domains, the nuclear matrix-binding, RNA-binding, and coiled-coil domains. J. Biol. Chem. 277: 20611-20617, 2002.
2. Nagase, T., Seki, N., Tanaka, A., Ishikawa, K., Nomura, N. Prediction of the coding sequences of unidentified human genes. IV. The coding sequences of 40 new genes (KIAA0121-KIAA0160) deduced by analysis of cDNA clones from human cell line KG-1. DNA Res. 2: 167-174, 1995.
2. Nagase, T., Seki, N., Tanaka, A., Ishikawa, K., Nomura, N. Prediction of the coding sequences of unidentified human genes. IV. The coding sequences of 40 new genes (KIAA0121-KIAA0160) deduced by analysis of cDNA clones from human cell line KG-1. DNA Res. 2: 167-174, 1995.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
MORC family CW-type zinc finger protein 3 isoform 1
NCBI Official Synonym Full Names
MORC family CW-type zinc finger 3
NCBI Official Symbol
MORC3
NCBI Official Synonym Symbols
NXP2; ZCW5; ZCWCC3
NCBI Protein Information
MORC family CW-type zinc finger protein 3
UniProt Protein Name
MORC family CW-type zinc finger protein 3
Protein Family
UniProt Gene Name
MORC3
UniProt Synonym Gene Names
KIAA0136; ZCWCC3
UniProt Entry Name
MORC3_HUMAN
NCBI Description
This gene encodes a protein that localizes to the nuclear matrix and forms nuclear bodies via an ATP-dependent mechanism. The protein is predicted to have coiled-coil and zinc finger domains and has RNA binding activity. Alternative splicing produces multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Feb 2016]
Research Articles on MORC3
Similar Products
Product Notes
The MORC3 morc3 (Catalog #AAA1753129) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-MORC3 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MORC3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin, Immunocytochemistry (ICC), Immunofluorescence (IF), Flow Cytometry (FC/FACS). WB: 0.25-0.5ug/ml (Mouse, Rat) IHC-P (Embedded Section): 0.5-1ug/ml (Human) ICC: 2ug/ml (Human) IF: 2ug/ml (Human) FC/FACS: 1-3ug/1x106 cells (Human) Tested Species: In-house tested species with positive results. Researchers should empirically determine the suitability of the MORC3 morc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MORC3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
