SDS-Page
MORC family CW-type zinc finger protein 3 (MORC3), partial Recombinant Protein | MORC3 recombinant protein
Recombinant Human MORC family CW-type zinc finger protein 3 (MORC3), partial
Gene Names
MORC3; NXP2; ZCW5; ZCWCC3
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
MORC family CW-type zinc finger protein 3 (MORC3); partial; Recombinant Human MORC family CW-type zinc finger protein 3 (MORC3); MORC family CW-type zinc finger protein 3; Zinc finger CW-type coiled-coil domain protein 3; MORC3 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-290. Partial
Sequence
MAAQPPRGIRLSALCPKFLHTNSTSHTWPFSAVAELIDNAYDPDVNAKQIWIDKTVINDHICLTFTDNGNGMTSDKLHKMLSFGFSDKVTMNGHVPVGLYGNGFKSGSMRLGKDAIVFTKNGESMSVGLLSQTYLEVIKAEHVVVPIVAFNKHRQMINLAESKASLAAILEHSLFSTEQKLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEITGKKGYKKQERMDQIAPESDYSLRAYCSILYLKPRMQIILRGQKVKTQLVSKSLAYIERDVY
Species
Homo sapiens (Human)
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-Page
SDS-Page
Related Product Information for MORC3 recombinant protein
Nuclear factor which forms MORC3-NBs (nuclear bodies) via an ATP-dependent mechanism (PubMed:20501696). Sumoylated MORC3-NBs can also associate with PML-NBs (PubMed:20501696). Recruits TP53 and SP100 to PML-NBs, thus regulating TP53 activity (PubMed:17332504). Binds RNA in vitro (PubMed:11927593). May be required for influenza A transcription during viral infection (PubMed:26202233).
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
48.7 kDa
NCBI Official Full Name
MORC family CW-type zinc finger protein 3
NCBI Official Synonym Full Names
MORC family CW-type zinc finger 3
NCBI Official Symbol
MORC3
NCBI Official Synonym Symbols
NXP2; ZCW5; ZCWCC3
NCBI Protein Information
MORC family CW-type zinc finger protein 3; nuclear matrix protein NXP2; zinc finger, CW type with coiled-coil domain 3; zinc finger, CW-type with coiled-coil domain 3; zinc finger CW-type coiled-coil domain protein 3
UniProt Protein Name
MORC family CW-type zinc finger protein 3
Protein Family
UniProt Gene Name
MORC3
UniProt Synonym Gene Names
KIAA0136; ZCWCC3
UniProt Entry Name
MORC3_HUMAN
NCBI Description
This gene encodes a protein that localizes to the nuclear matrix. The protein also has RNA binding activity, and has a predicted coiled-coil domain. [provided by RefSeq, Jul 2008]
Uniprot Description
MORC3:
Protein type: Cell cycle regulation; RNA-binding
Chromosomal Location of Human Ortholog: 21q22.13
Cellular Component: nucleoplasm; intermediate filament cytoskeleton; PML body
Molecular Function: zinc ion binding
Biological Process: peptidyl-serine phosphorylation; protein stabilization; negative regulation of fibroblast proliferation; cell aging; maintenance of protein localization in nucleus; protein amino acid phosphorylation; post-embryonic development
Research Articles on MORC3
Similar Products
Product Notes
The MORC3 morc3 (Catalog #AAA1330158) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-290. Partial. The amino acid sequence is listed below: MAAQPPRGIR LSALCPKFLH TNSTSHTWPF SAVAELIDNA YDPDVNAKQI WIDKTVINDH ICLTFTDNGN GMTSDKLHKM LSFGFSDKVT MNGHVPVGLY GNGFKSGSMR LGKDAIVFTK NGESMSVGLL SQTYLEVIKA EHVVVPIVAF NKHRQMINLA ESKASLAAIL EHSLFSTEQK LLAELDAIIG KKGTRIIIWN LRSYKNATEF DFEKDKYDIR IPEDLDEITG KKGYKKQERM DQIAPESDYS LRAYCSILYL KPRMQIILRG QKVKTQLVSK SLAYIERDVY . It is sometimes possible for the material contained within the vial of "MORC family CW-type zinc finger protein 3 (MORC3), partial, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
