Western Blot (WB)
(WB Suggested Anti-MOGAT2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)
Rabbit MOGAT2 Polyclonal Antibody | anti-MOGAT2 antibody
MOGAT2 antibody - middle region
Gene Names
MOGAT2; hDC5; MGAT2; DGAT2L5; DGAT2L5.
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MOGAT2; Polyclonal Antibody; MOGAT2 antibody - middle region; anti-MOGAT2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLGIIVGGAQEALDARPGSFTLLLRNRKGFVRLALTHGAPLVPIFSFGEN
Sequence Length
334
Applicable Applications for anti-MOGAT2 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 92%; Guinea Pig: 86%; Horse: 85%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 100%; Rat: 100%; Yeast: 77%; Zebrafish: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MOGAT2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-MOGAT2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)
Western Blot (WB)
(WB Suggested Anti-MOGAT2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)
Related Product Information for anti-MOGAT2 antibody
This is a rabbit polyclonal antibody against MOGAT2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Dietary fat absorption from the small intestine is facilitated by acyl-CoA:monoacylglycerol transferase (MOGAT) and acyl-CoA:diacylglycerol acyltransferase (DGAT) activities. MOGAT catalyzes the joining of monoacylglycerol and fatty acyl-CoAs to form diacylglycerol.Dietary fat absorption from the small intestine is facilitated by acyl-CoA:monoacylglycerol transferase (MOGAT; EC 2.3.1.22) and acyl-CoA:diacylglycerol acyltransferase (DGAT; see MIM 604900) activities. MOGAT catalyzes the joining of monoacylglycerol and fatty acyl-CoAs to form diacylglycerol (Yen and Farese, 2003 [PubMed 12621063]).[supplied by OMIM].
Target Description: Dietary fat absorption from the small intestine is facilitated by acyl-CoA:monoacylglycerol transferase (MOGAT) and acyl-CoA:diacylglycerol acyltransferase (DGAT) activities. MOGAT catalyzes the joining of monoacylglycerol and fatty acyl-CoAs to form diacylglycerol.Dietary fat absorption from the small intestine is facilitated by acyl-CoA:monoacylglycerol transferase (MOGAT; EC 2.3.1.22) and acyl-CoA:diacylglycerol acyltransferase (DGAT; see MIM 604900) activities. MOGAT catalyzes the joining of monoacylglycerol and fatty acyl-CoAs to form diacylglycerol (Yen and Farese, 2003 [PubMed 12621063]).[supplied by OMIM].
Product Categories/Family for anti-MOGAT2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
2-acylglycerol O-acyltransferase 2
NCBI Official Synonym Full Names
monoacylglycerol O-acyltransferase 2
NCBI Official Symbol
MOGAT2
NCBI Official Synonym Symbols
hDC5; MGAT2; DGAT2L5; DGAT2L5.
NCBI Protein Information
2-acylglycerol O-acyltransferase 2
UniProt Protein Name
2-acylglycerol O-acyltransferase 2
Protein Family
UniProt Gene Name
MOGAT2
UniProt Synonym Gene Names
DC5; DGAT2L5; MGAT2; hMGAT2; hDC5
NCBI Description
The protein encoded by this gene is an enzyme that catalyzes the synthesis of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA. The encoded protein is important in the uptake of dietary fat by the small intestine. This protein forms a complex with diacylglycerol O-acyltransferase 2 in the endoplasmic reticulum, and this complex catalyzes the synthesis of triacylglycerol. [provided by RefSeq, Dec 2015]
Uniprot Description
Catalyzes the formation of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA. Has a preference toward monoacylglycerols containing unsaturated fatty acids in an order of C18:3 > C18:2 > C18:1 > C18:0. Plays a central role in absorption of dietary fat in the small intestine by catalyzing the resynthesis of triacylglycerol in enterocytes. May play a role in diet-induced obesity.
Research Articles on MOGAT2
Similar Products
Product Notes
The MOGAT2 mogat2 (Catalog #AAA3209702) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MOGAT2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MOGAT2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MOGAT2 mogat2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLGIIVGGAQ EALDARPGSF TLLLRNRKGF VRLALTHGAP LVPIFSFGEN. It is sometimes possible for the material contained within the vial of "MOGAT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
