Western Blot (WB)
(MOGAT1 antibody (MBS839560) used at 1 ug/ml to detect target protein.)
Rabbit anti-Human, Mouse MOGAT1 Polyclonal Antibody | anti-MOGAT1 antibody
MOGAT1 antibody
Gene Names
Mogat1; mDC2; MGAT1; Dgat2l; Dgat2l1; 0610030A14Rik; 1110064N14Rik; WI1-2612I11.1
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
MOGAT1; Polyclonal Antibody; MOGAT1 antibody; Polyclonal MOGAT1; Anti-MOGAT1; MOGAT-1; MOGAT 1; Monoacylglycerol O-Acyltransferase 1; DGAT2L; MGAT1; DGAT2L1; anti-MOGAT1 antibody
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Specificity
MOGAT1 antibody was raised against the C terminal of MOGAT1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MOGAT1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
335
Applicable Applications for anti-MOGAT1 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
Acyl-CoA:monoacylglycerol acyltransferase (MOGAT; EC 2.3.1.22) catalyzes the synthesis of diacylglycerols, the precursor of physiologically important lipids such as triacylglycerol and phospholipids.
Cross-Reactivity
Human,Mouse
Immunogen
MOGAT1 antibody was raised using the C terminal of MOGAT1 corresponding to a region with amino acids PIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(MOGAT1 antibody (MBS839560) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(MOGAT1 antibody (MBS839560) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-MOGAT1 antibody
Rabbit polyclonal MOGAT1 antibody raised against the C terminal of MOGAT1
Product Categories/Family for anti-MOGAT1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
39 kDa (MW of target protein)
NCBI Official Full Name
Mogat1 protein
NCBI Official Synonym Full Names
monoacylglycerol O-acyltransferase 1
NCBI Official Symbol
Mogat1
NCBI Official Synonym Symbols
mDC2; MGAT1; Dgat2l; Dgat2l1; 0610030A14Rik; 1110064N14Rik; WI1-2612I11.1
NCBI Protein Information
2-acylglycerol O-acyltransferase 1
UniProt Protein Name
2-acylglycerol O-acyltransferase 1
Protein Family
UniProt Gene Name
Mogat1
UniProt Synonym Gene Names
Dgat2l1; MGAT1
UniProt Entry Name
MOGT1_MOUSE
Uniprot Description
MOGAT1: Catalyzes the formation of diacylglycerol from 2- monoacylglycerol and fatty acyl-CoA. Probably not involved in absorption of dietary fat in the small intestine. Belongs to the diacylglycerol acyltransferase family.
Protein type: EC 2.3.1.22; Transferase; Endoplasmic reticulum; Membrane protein, integral; Membrane protein, multi-pass
Cellular Component: membrane; endoplasmic reticulum; integral to membrane
Molecular Function: 2-acylglycerol O-acyltransferase activity; transferase activity; transferase activity, transferring acyl groups; transferase activity, transferring groups other than amino-acyl groups; diacylglycerol O-acyltransferase activity
Biological Process: diacylglycerol biosynthetic process; glycerol metabolic process; lipid metabolic process
Research Articles on MOGAT1
Similar Products
Product Notes
The MOGAT1 mogat1 (Catalog #AAA839560) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MOGAT1 antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's MOGAT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the MOGAT1 mogat1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MOGAT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
