Western Blot (WB)
(Host: RabbitTarget Name: MOGAT1Sample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
Rabbit MOGAT1 Polyclonal Antibody | anti-MOGAT1 antibody
MOGAT1 antibody - C-terminal region
Gene Names
MOGAT1; MGAT1; DGAT2L; DGAT2L1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MOGAT1; Polyclonal Antibody; MOGAT1 antibody - C-terminal region; anti-MOGAT1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PIPVRQTLNPTQEQIEELHQTYMEELRKLFEEHKGKYGIPEHETLVLK
Sequence Length
335
Applicable Applications for anti-MOGAT1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 92%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human MOGAT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: MOGAT1Sample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: MOGAT1Sample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(WB Suggested Anti-MOGAT1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)
Western Blot (WB)
(WB Suggested Anti-MOGAT1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Liver)
Related Product Information for anti-MOGAT1 antibody
This is a rabbit polyclonal antibody against MOGAT1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Acyl-CoA:monoacylglycerol acyltransferase (MOGAT; EC 2.3.1.22) catalyzes the synthesis of diacylglycerols, the precursor of physiologically important lipids such as triacylglycerol and phospholipids.Acyl-CoA:monoacylglycerol acyltransferase (MOGAT; EC 2.3.1.22) catalyzes the synthesis of diacylglycerols, the precursor of physiologically important lipids such as triacylglycerol and phospholipids (Yen et al., 2002 [PubMed 12077311]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-48 AF384163.1 1-48 49-1056 BN000154.1 1-1008 1057-1096 AF384163.1 1054-1093
Target Description: Acyl-CoA:monoacylglycerol acyltransferase (MOGAT; EC 2.3.1.22) catalyzes the synthesis of diacylglycerols, the precursor of physiologically important lipids such as triacylglycerol and phospholipids.Acyl-CoA:monoacylglycerol acyltransferase (MOGAT; EC 2.3.1.22) catalyzes the synthesis of diacylglycerols, the precursor of physiologically important lipids such as triacylglycerol and phospholipids (Yen et al., 2002 [PubMed 12077311]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-48 AF384163.1 1-48 49-1056 BN000154.1 1-1008 1057-1096 AF384163.1 1054-1093
Product Categories/Family for anti-MOGAT1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
2-acylglycerol O-acyltransferase 1
NCBI Official Synonym Full Names
monoacylglycerol O-acyltransferase 1
NCBI Official Symbol
MOGAT1
NCBI Official Synonym Symbols
MGAT1; DGAT2L; DGAT2L1
NCBI Protein Information
2-acylglycerol O-acyltransferase 1
UniProt Protein Name
2-acylglycerol O-acyltransferase 1
Protein Family
UniProt Gene Name
MOGAT1
UniProt Synonym Gene Names
DC2; DGAT2L1; MGAT1; hDC2
UniProt Entry Name
MOGT1_HUMAN
NCBI Description
Acyl-CoA:monoacylglycerol acyltransferase (MOGAT; EC 2.3.1.22) catalyzes the synthesis of diacylglycerols, the precursor of physiologically important lipids such as triacylglycerol and phospholipids (Yen et al., 2002 [PubMed 12077311]).[supplied by OMIM, Mar 2008]
Similar Products
Product Notes
The MOGAT1 mogat1 (Catalog #AAA3209854) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MOGAT1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MOGAT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MOGAT1 mogat1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PIPVRQTLNP TQEQIEELHQ TYMEELRKLF EEHKGKYGIP EHETLVLK. It is sometimes possible for the material contained within the vial of "MOGAT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
