Western Blot (WB)
(Host: RabbitTarget Name: MOB2Sample Tissue: Human Liver TumorAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human MOB2 Polyclonal Antibody | anti-MOB2 antibody
MOB2 Antibody - middle region
Gene Names
MOB2; HCCA2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MOB2; Polyclonal Antibody; MOB2 Antibody - middle region; anti-MOB2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QTMAVCNTQYYWYDERGKKVKCTAPQYVDFVMSSVQKLVTDEDVFPTKYG
Sequence Length
237
Applicable Applications for anti-MOB2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MOB2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: MOB2Sample Tissue: Human Liver TumorAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: MOB2Sample Tissue: Human Liver TumorAntibody Dilution: 1.0ug/ml)
Product Categories/Family for anti-MOB2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27 kDa
NCBI Official Full Name
MOB kinase activator 2 isoform 1
NCBI Official Synonym Full Names
MOB kinase activator 2
NCBI Official Symbol
MOB2
NCBI Official Synonym Symbols
HCCA2
NCBI Protein Information
MOB kinase activator 2
UniProt Protein Name
MOB kinase activator 2
Protein Family
UniProt Gene Name
MOB2
UniProt Synonym Gene Names
HCCA2
UniProt Entry Name
MOB2_HUMAN
Uniprot Description
HCCA2: Stimulates the autophosphorylation and kinase activity of STK38 and STK38L. Belongs to the MOB1/phocein family. 2 isoforms of the human protein are produced by alternative splicing.
Chromosomal Location of Human Ortholog: 11p15.5
Cellular Component: perinuclear region of cytoplasm; cytoplasm; nucleolus; nucleus
Molecular Function: metal ion binding
Biological Process: positive regulation of protein amino acid phosphorylation; actin cytoskeleton organization and biogenesis
Research Articles on MOB2
Similar Products
Product Notes
The MOB2 mob2 (Catalog #AAA3220882) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MOB2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MOB2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MOB2 mob2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QTMAVCNTQY YWYDERGKKV KCTAPQYVDF VMSSVQKLVT DEDVFPTKYG. It is sometimes possible for the material contained within the vial of "MOB2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
