Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of MMP13 expression in HELA whole cell lysates (lane 1). MMP13 at 54KD was detected using rabbit anti- MMP13 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method )

Rabbit anti-Human MMP13 Polyclonal Antibody | anti-MMP13 antibody

Anti-MMP13 Antibody

Gene Names
MMP13; CLG3; MDST; MANDP1; MMP-13
Reactivity
Human
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
MMP13; Polyclonal Antibody; Anti-MMP13 Antibody; CLG 3; CLG3; Collagenase 3; Collagenase3; MANDP1; MDST; MMP-13; MMP 13; P45452; matrix metallopeptidase 13; anti-MMP13 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
471
Applicable Applications for anti-MMP13 antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5ug/ml
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human MMP13 (109-154aa RTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFT), different from the related mouse sequence by four amino acids, and from the related rat sequence by five amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of MMP13 expression in HELA whole cell lysates (lane 1). MMP13 at 54KD was detected using rabbit anti- MMP13 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method )

Western Blot (WB) (Western blot analysis of MMP13 expression in HELA whole cell lysates (lane 1). MMP13 at 54KD was detected using rabbit anti- MMP13 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method )
Related Product Information for anti-MMP13 antibody
Rabbit IgG polyclonal antibody for Collagenase 3 (MMP13) detection.
Background: Collagenase 3 is an enzyme that in humans is encoded by the MMP13 gene. This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This protease cleaves type II collagen more efficiently than types I and III. It may be involved in articular cartilage turnover and cartilage pathophysiology associated with osteoarthritis. Mutations in this gene are associated with metaphyseal anadysplasia. This gene is part of a cluster of MMP genes on chromosome 11.
References
1. "Entrez Gene: MMP13 matrix metallopeptidase 13 (collagenase 3)".
2. Freije JM, Diez-Itza I, Balbin M, Sanchez LM, Blasco R, Tolivia J, Lopez-Otin C (Jul 1994). "Molecular cloning and expression of collagenase-3, a novel human matrix metalloproteinase produced by breast carcinomas". J Biol Chem. 269 (24): 16766-73.
3. Johansson N, Ahonen M, Kähäri VM (2000). "Matrix metalloproteinases in tumor invasion.". Cell Mol Life Sci. 57 (1): 5-15.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53,820 Da
NCBI Official Full Name
collagenase 3 preproprotein
NCBI Official Synonym Full Names
matrix metallopeptidase 13
NCBI Official Symbol
MMP13
NCBI Official Synonym Symbols
CLG3; MDST; MANDP1; MMP-13
NCBI Protein Information
collagenase 3
UniProt Protein Name
Collagenase 3
Protein Family
UniProt Gene Name
MMP13
UniProt Synonym Gene Names
MMP-13

NCBI Description

This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This protease cleaves type II collagen more efficiently than types I and III. It may be involved in articular cartilage turnover and cartilage pathophysiology associated with osteoarthritis. Mutations in this gene are associated with metaphyseal anadysplasia. This gene is part of a cluster of MMP genes on chromosome 11. [provided by RefSeq, Jan 2016]

Uniprot Description

MMP13: Degrades collagen type I. Does not act on gelatin or casein. Could have a role in tumoral process. Defects in MMP13 are the cause of spondyloepimetaphyseal dysplasia Missouri type (SEMD-MO). A bone disease characterized by moderate to severe metaphyseal changes, mild epiphyseal involvement, rhizomelic shortening of the lower limbs with bowing of the femora and/or tibiae, coxa vara, genu varum and pear-shaped vertebrae in childhood. Epimetaphyseal changes improve with age. Defects in MMP13 are the cause of metaphyseal anadysplasia type 1 (MANDP1). Metaphyseal anadysplasia consists of an abnormal bone development characterized by severe skeletal changes that, in contrast with the progressive course of most other skeletal dysplasias, resolve spontaneously with age. Clinical characteristics are evident from the first months of life and include slight shortness of stature and a mild varus deformity of the legs. Patients attain a normal stature in adolescence and show improvement or complete resolution of varus deformity of the legs and rhizomelic micromelia. Belongs to the peptidase M10A family.

Protein type: EC 3.4.24.-; Protease; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 11q22.2

Cellular Component: extracellular region; extracellular space

Molecular Function: calcium ion binding; collagen binding; metalloendopeptidase activity; serine-type endopeptidase activity; zinc ion binding

Biological Process: collagen catabolic process; extracellular matrix disassembly

Disease: Metaphyseal Dysplasia, Spahr Type; Spondyloepimetaphyseal Dysplasia, Missouri Type

Research Articles on MMP13

Similar Products

Product Notes

The MMP13 mmp13 (Catalog #AAA178611) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-MMP13 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MMP13 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the MMP13 mmp13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MMP13, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.