Mouse anti-Human OCLN Monoclonal Antibody | anti-OCLN antibody

OCLN (Occludin) (HRP)

Cat. Num. AAA6153908

• Gene Names: OCLN; BLCPMG; PTORCH1; PPP1R115
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: OCLN; Monoclonal Antibody; OCLN (Occludin) (HRP); anti-OCLN antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1G7
• Specificity: Recognizes human OCLN.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-OCLN antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa423-523 from human OCLN (NP_002529) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(OCLN monoclonal antibody. Western Blot analysis of OCLN expression in HL-60)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to OCLN on HeLa cell. [antibody concentration 10ug/ml])

Immunoprecipitation (IP)

(Immunoprecipitation of OCLN transfected lysate using OCLN monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with OCLN rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged OCLN is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-OCLN antibody

May play a role in the formation and regulation of the tight junction (TJ) paracellular permeability barrier. It is able to induce adhesion when expressed in cells lacking tight junctions.

Product Categories/Family for anti-OCLN antibody

Antibodies; Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 4505487
• NCBI GeneID: 100506658
• NCBI Accession #: NP_002529
• NCBI GenBank Nucleotide #: NM_002538
• UniProt Accession #: Q16625
• Molecular Weight: 59kDa
• NCBI Official Full Name: occludin isoform a
• NCBI Official Synonym Full Names: occludin
• NCBI Official Symbol: OCLN
• NCBI Official Synonym Symbols: BLCPMG; PTORCH1; PPP1R115
• NCBI Protein Information: occludin
• UniProt Protein Name: Occludin
• Protein Family: Occludin
• UniProt Gene Name: OCLN
• UniProt Entry Name: OCLN_HUMAN

NCBI Description

This gene encodes an integral membrane protein that is required for cytokine-induced regulation of the tight junction paracellular permeability barrier. Mutations in this gene are thought to be a cause of band-like calcification with simplified gyration and polymicrogyria (BLC-PMG), an autosomal recessive neurologic disorder that is also known as pseudo-TORCH syndrome. Alternative splicing results in multiple transcript variants. A related pseudogene is present 1.5 Mb downstream on the q arm of chromosome 5. [provided by RefSeq, Apr 2011]

Uniprot Description

occludin: May play a role in the formation and regulation of the tight junction (TJ) paracellular permeability barrier. It is able to induce adhesion when expressed in cells lacking tight junctions. Interacts with TJP1/ZO1 and with VAPA. Localized at tight junctions of both epithelial and endothelial cells. Highly expressed in kidney. Not detected in testis. Belongs to the ELL/occludin family. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Cell adhesion; Membrane protein, integral; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 5q13.1

Cellular Component: tight junction; apicolateral plasma membrane; endocytic vesicle; apical plasma membrane; integral to membrane; plasma membrane; intercellular junction; cytoplasmic vesicle; cell junction; cytosol

Molecular Function: thiopurine S-methyltransferase activity; protein domain specific binding; protein binding; structural molecule activity

Biological Process: methylation; intercellular junction assembly and maintenance; apoptosis; S-adenosylmethionine metabolic process; S-adenosylhomocysteine metabolic process; protein complex assembly; cell structure disassembly during apoptosis

Disease: Band-like Calcification With Simplified Gyration And Polymicrogyria