Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- antibody, PBMMP12, Western blottingAll lanes: Anti MMP12 at 0.5ug/ml)

anti-Mouse MMP12 Polyclonal Antibody | anti-MMP12 antibody

Anti-MMP12 Antibody

Gene Names
Mmp12; MME; Mmel; AV378681
Reactivity
Mouse
Applications
Western Blot, ELISA
Purity
Immunogen Affinity Purified
Synonyms
MMP12; Polyclonal Antibody; Anti-MMP12 Antibody; Macrophage metalloelastase; EC 3.4.24.65; HME; Macrophage elastase; Macrophage metaloelastase; Matrix metallopeptidase 12 (macrophage elastase); Matrix metalloprotease 12; Matrix metalloproteinase-12; ME; MGC138506; MME; MMP 12; MMP-12; Mmp12; MMP12_HUMAN antibody; matrix metallopeptidase 12 (macrophage elastase); anti-MMP12 antibody
Ordering
For Research Use Only!
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
420
Applicable Applications for anti-MMP12 antibody
Western Blot (WB), ELISA (EIA)
Application Notes
ELISA Concentration: 0.1-0.5ug/ml
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of mouse MMP12 (432-466aa KIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLK), different from the related human sequence by thirteen amino acids, and from the related rat sequence by three amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- antibody, PBMMP12, Western blottingAll lanes: Anti MMP12 at 0.5ug/ml)

Western Blot (WB) (Anti- antibody, PBMMP12, Western blottingAll lanes: Anti MMP12 at 0.5ug/ml)
Related Product Information for anti-MMP12 antibody
Description: Rabbit IgG polyclonal antibody for Macrophage metalloelastase(MMP12) detection. Tested with WB, ELISA in Mouse.

Background: Matrix metalloproteinase-12 (MMP12), also known as MME or ME, is an enzyme that in humans is encoded by the MMP12 gene. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.2. It is thought that the protein encoded by this gene is cleaved at both ends to yield the active enzyme, but this processing has not been fully described. The enzyme degrades soluble and insoluble elastin. It may play a role in aneurysm formation and studies in mice suggest a role in the development of emphysema. This gene may involved in tissue injury and remodeling.
References
1. Houghton, A. M., Hartzell, W. O., Robbins, C. S., Gomis-Ruth, F. X., Shapiro, S. D.Macrophage elastase kills bacteria within murine macrophages. Nature 460: 637-641, 2009. 2. Joos, L., He, J.-Q., Shepherdson, M. B., Connett, J. E., Anthonisen, N. R., Pare, P. D., Sandford, A. J. The role of matrix metalloproteinase polymorphisms in the rate of decline in lung function. Hum. Molec. Genet. 11: 569-576, 2002. Note: Erratum: Hum. Molec. Genet. 12: 803-804, 2003. 3. Wu, L., Tanimoto, A., Murata, Y., Sasaguri, T., Fan, J., Sasaguri, Y., Watanabe, T. Matrix metalloproteinase-12 gene expression in human vascular smooth muscle cells.Genes Cells 8: 225-234, 2003.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
54,971 Da
NCBI Official Full Name
macrophage metalloelastase isoform 2
NCBI Official Synonym Full Names
matrix metallopeptidase 12
NCBI Official Symbol
Mmp12
NCBI Official Synonym Symbols
MME; Mmel; AV378681
NCBI Protein Information
macrophage metalloelastase
UniProt Protein Name
Macrophage metalloelastase
UniProt Gene Name
Mmp12
UniProt Synonym Gene Names
Mme; Mmel; MME; MMP-12
UniProt Entry Name
MMP12_MOUSE

NCBI Description

This gene encodes a member of the matrix metalloproteinase family of extracellular matrix-degrading enzymes that are involved in tissue remodeling, wound repair, progression of atherosclerosis and tumor invasion. The encoded preproprotein undergoes proteolytic processing to generate a mature, zinc-dependent endopeptidase enzyme. Mice lacking the encoded protein have a diminished capacity to degrade extracellular matrix components, do not develop emphysema in response to long-term exposure to cigarette smoke, and exhibit impaired clearance and increased mortality upon bacterial infection. This gene is located in a cluster of other matrix metalloproteinase genes on chromosome 9. Alternate splicing generates multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Feb 2016]

Uniprot Description

MMP12: May be involved in tissue injury and remodeling. Has significant elastolytic activity. Can accept large and small amino acids at the P1' site, but has a preference for leucine. Aromatic or hydrophobic residues are preferred at the P1 site, with small hydrophobic residues (preferably alanine) occupying P3. Belongs to the peptidase M10A family.

Protein type: Protease; EC 3.4.24.65; Secreted, signal peptide; Secreted

Cellular Component: extracellular matrix; extracellular region; proteinaceous extracellular matrix

Molecular Function: calcium ion binding; hydrolase activity; metal ion binding; metalloendopeptidase activity; metallopeptidase activity; peptidase activity; zinc ion binding

Biological Process: positive regulation of epithelial cell proliferation involved in wound healing; proteolysis; wound healing; wound healing, spreading of epidermal cells

Research Articles on MMP12

Similar Products

Product Notes

The MMP12 mmp12 (Catalog #AAA178278) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-MMP12 Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's MMP12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), ELISA (EIA). ELISA Concentration: 0.1-0.5ug/ml Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the MMP12 mmp12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MMP12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.