Western Blot (WB)
(WB Suggested Anti-HMGCS2 Antibody Titration: 1.25ug/mlPositive Control: Human Liver)
Rabbit HMGCS2 Polyclonal Antibody | anti-HMGCS2 antibody
HMGCS2 antibody - C-terminal region
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
HMGCS2; Polyclonal Antibody; HMGCS2 antibody - C-terminal region; anti-HMGCS2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWYLE
Sequence Length
508
Applicable Applications for anti-HMGCS2 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 100%; Goat: 79%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human HMGCS2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-HMGCS2 Antibody Titration: 1.25ug/mlPositive Control: Human Liver)
Western Blot (WB)
(WB Suggested Anti-HMGCS2 Antibody Titration: 1.25ug/mlPositive Control: Human Liver)
Related Product Information for anti-HMGCS2 antibody
This is a rabbit polyclonal antibody against HMGCS2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: This enzyme condenses acetyl-CoA with acetoacetyl-CoA to form HMG-CoA, which is the substrate for HMG-CoA reductase.
Target Description: This enzyme condenses acetyl-CoA with acetoacetyl-CoA to form HMG-CoA, which is the substrate for HMG-CoA reductase.
Product Categories/Family for anti-HMGCS2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
hydroxymethylglutaryl-CoA synthase, mitochondrial isoform 1
NCBI Official Synonym Full Names
3-hydroxy-3-methylglutaryl-CoA synthase 2
NCBI Official Symbol
HMGCS2
NCBI Protein Information
hydroxymethylglutaryl-CoA synthase, mitochondrial
UniProt Protein Name
Hydroxymethylglutaryl-CoA synthase, mitochondrial
UniProt Gene Name
HMGCS2
UniProt Synonym Gene Names
HMG-CoA synthase
UniProt Entry Name
HMCS2_HUMAN
NCBI Description
The protein encoded by this gene belongs to the HMG-CoA synthase family. It is a mitochondrial enzyme that catalyzes the first reaction of ketogenesis, a metabolic pathway that provides lipid-derived energy for various organs during times of carbohydrate deprivation, such as fasting. Mutations in this gene are associated with HMG-CoA synthase deficiency. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2009]
Research Articles on HMGCS2
Similar Products
Product Notes
The HMGCS2 hmgcs2 (Catalog #AAA3205917) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HMGCS2 antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's HMGCS2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HMGCS2 hmgcs2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DLPKRLASRK CVSPEEFTEI MNQREQFYHK VNFSPPGDTN SLFPGTWYLE. It is sometimes possible for the material contained within the vial of "HMGCS2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
