Western Blot (WB)
(Host: RabbitTarget Name: GPSN2Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)
Rabbit GPSN2 Polyclonal Antibody | anti-TECR antibody
GPSN2 antibody - middle region
Gene Names
TECR; SC2; TER; GPSN2; MRT14
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
GPSN2; Polyclonal Antibody; GPSN2 antibody - middle region; anti-TECR antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PFIYGHKYDFTSSRHTVVHLACICHSFHYIKRLLETLFVHRFSHGTMPLR
Sequence Length
308
Applicable Applications for anti-TECR antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human GPSN2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: GPSN2Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: GPSN2Sample Type: Human Fetal BrainAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(WB Suggested Anti-GPSN2 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)
Western Blot (WB)
(WB Suggested Anti-GPSN2 Antibody Titration: 0.2-1 ug/mlPositive Control: 721_B cell lysate)
Related Product Information for anti-TECR antibody
This is a rabbit polyclonal antibody against GPSN2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Microsomal long and very long chain fatty acid elongation uses malonyl-CoA as the 2-carbon donor and consists of 4 sequential reactions. GPSN2 catalyzes the final step, reducing trans-2,3-enoyl-CoA to saturated acyl-CoA. Microsomal long and very long chain fatty acid elongation uses malonyl-CoA as the 2-carbon donor and consists of 4 sequential reactions. TER catalyzes the final step, reducing trans-2,3-enoyl-CoA to saturated acyl-CoA (Moon and Horton, 2003 [PubMed 12482854]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-680 BG705196.1 7-686 681-1197 BC013881.2 632-1148
Target Description: Microsomal long and very long chain fatty acid elongation uses malonyl-CoA as the 2-carbon donor and consists of 4 sequential reactions. GPSN2 catalyzes the final step, reducing trans-2,3-enoyl-CoA to saturated acyl-CoA. Microsomal long and very long chain fatty acid elongation uses malonyl-CoA as the 2-carbon donor and consists of 4 sequential reactions. TER catalyzes the final step, reducing trans-2,3-enoyl-CoA to saturated acyl-CoA (Moon and Horton, 2003 [PubMed 12482854]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-680 BG705196.1 7-686 681-1197 BC013881.2 632-1148
Product Categories/Family for anti-TECR antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
very-long-chain enoyl-CoA reductase isoform 1
NCBI Official Synonym Full Names
trans-2,3-enoyl-CoA reductase
NCBI Official Symbol
TECR
NCBI Official Synonym Symbols
SC2; TER; GPSN2; MRT14
NCBI Protein Information
very-long-chain enoyl-CoA reductase
UniProt Protein Name
Very-long-chain enoyl-CoA reductase
UniProt Gene Name
TECR
UniProt Synonym Gene Names
GPSN2; SC2; TER
UniProt Entry Name
TECR_HUMAN
NCBI Description
This gene encodes a multi-pass membrane protein that resides in the endoplasmic reticulum, and belongs to the steroid 5-alpha reductase family. The elongation of microsomal long and very long chain fatty acid consists of 4 sequential reactions. This protein catalyzes the final step, reducing trans-2,3-enoyl-CoA to saturated acyl-CoA. Alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, Apr 2011]
Research Articles on TECR
Similar Products
Product Notes
The TECR tecr (Catalog #AAA3209013) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The GPSN2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's GPSN2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TECR tecr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PFIYGHKYDF TSSRHTVVHL ACICHSFHYI KRLLETLFVH RFSHGTMPLR. It is sometimes possible for the material contained within the vial of "GPSN2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
