Rabbit anti-Human MKNK1 Polyclonal Antibody | anti-MKNK1 antibody

MKNK1 Antibody - N-terminal region

Cat. Num. AAA3221687

• Gene Names: MKNK1; MNK1
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: MKNK1; Polyclonal Antibody; MKNK1 Antibody - N-terminal region; anti-MKNK1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: EPLPIADGDRRRKKKRRGRATDSLPGKFEDMYKLTSELLGEGAYAKVQGA
• Sequence Length: 465

• Applicable Applications for anti-MKNK1 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MKNK1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MKNK1Sample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-MKNK1 antibody

This gene encodes a Ser/Thr protein kinase that interacts with, and is activated by ERK1 and p38 mitogen-activated protein kinases, and thus may play a role in the response to environmental stress and cytokines. This kinase may also regulate transcription by phosphorylating eIF4E via interaction with the C-terminal region of eIF4G. Alternatively spliced transcript variants have been noted for this gene.

Product Categories/Family for anti-MKNK1 antibody

Polyclonal; Transcription Regulation; Protein Kinases; Apoptosis; DNA/RNA/Protein Interactions

NCBI and Uniprot Product Information

• NCBI GI #: 207113186
• NCBI GeneID: 8569
• NCBI Accession #: NP_001129025.1
• NCBI GenBank Nucleotide #: NM_001135553.2
• UniProt Accession #: Q9BUB5
• Molecular Weight: 51 kDa
• NCBI Official Full Name: MAP kinase-interacting serine/threonine-protein kinase 1 isoform 3
• NCBI Official Synonym Full Names: MAP kinase interacting serine/threonine kinase 1
• NCBI Official Symbol: MKNK1
• NCBI Official Synonym Symbols: MNK1
• NCBI Protein Information: MAP kinase-interacting serine/threonine-protein kinase 1
• UniProt Protein Name: MAP kinase-interacting serine/threonine-protein kinase 1
• Protein Family: MAP kinase-interacting serine/threonine-protein kinase
• UniProt Gene Name: MKNK1
• UniProt Synonym Gene Names: MNK1; MAPK signal-integrating kinase 1; Mnk1
• UniProt Entry Name: MKNK1_HUMAN

NCBI Description

This gene encodes a Ser/Thr protein kinase that interacts with, and is activated by ERK1 and p38 mitogen-activated protein kinases, and thus may play a role in the response to environmental stress and cytokines. This kinase may also regulate transcription by phosphorylating eIF4E via interaction with the C-terminal region of eIF4G. Alternatively spliced transcript variants have been noted for this gene. [provided by RefSeq, Jan 2012]

Uniprot Description

Mnk1: a CAM kinase of the MAPKKAPK family that can regulate translation. Following activation by MAP kinases, Mnk1 phosphorylates eIF4E at Ser209, increasing its affinity for the 7-methylguanosine-containing mRNA cap. Two MAPK phosphorylation sites in mouse Mnk1 (Thr197 and Thr202) are essential for its kinase activity. Three alternatively spliced human isoforms have been described.

Protein type: Protein kinase, CAMK; EC 2.7.11.1; Translation; Kinase, protein; Protein kinase, Ser/Thr (non-receptor); CAMK group; MAPKAPK family; MNK subfamily

Chromosomal Location of Human Ortholog: 1p33

Cellular Component: nucleus; cytosol

Molecular Function: protein serine/threonine kinase activity; protein binding; ATP binding

Biological Process: peptidyl-serine phosphorylation; fibroblast growth factor receptor signaling pathway; protein amino acid phosphorylation; response to salt stress; regulation of translational initiation