Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MICU1 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellMICU1 is supported by BioGPS gene expression data to be expressed in MCF7)

Rabbit MICU1 Polyclonal Antibody | anti-MICU1 antibody

MICU1 Antibody - C-terminal region

Gene Names
MICU1; CALC; EFHA3; MPXPS; CBARA1; ara CALC
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MICU1; Polyclonal Antibody; MICU1 Antibody - C-terminal region; anti-MICU1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LSDHVCDVVFALFDCDGNGELSNKEFVSIMKQRLMRGLEKPKDMGFTRLM
Sequence Length
278
Applicable Applications for anti-MICU1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MICU1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MICU1 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellMICU1 is supported by BioGPS gene expression data to be expressed in MCF7)

Western Blot (WB) (WB Suggested Anti-MICU1 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole CellMICU1 is supported by BioGPS gene expression data to be expressed in MCF7)
Related Product Information for anti-MICU1 antibody
This is a rabbit polyclonal antibody against MICU1. It was validated on Western Blot

Target Description: MICU1 is a key regulator of mitochondrial calcium uptake required for calcium entry into mitochondrion. It may act as a calcium sensor via its EF-hand domains, gating the activity of a calcium channel partner. MICU1 induces T-helper 1-mediated autoreactivity, which is accompanied by the release of IFNG.
Product Categories/Family for anti-MICU1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
calcium uptake protein 1, mitochondrial isoform 3
NCBI Official Synonym Full Names
mitochondrial calcium uptake 1
NCBI Official Symbol
MICU1
NCBI Official Synonym Symbols
CALC; EFHA3; MPXPS; CBARA1; ara CALC
NCBI Protein Information
calcium uptake protein 1, mitochondrial
UniProt Protein Name
Calcium uptake protein 1, mitochondrial
Protein Family
UniProt Gene Name
MICU1
UniProt Synonym Gene Names
CALC; CBARA1; ara CALC
UniProt Entry Name
MICU1_HUMAN

NCBI Description

This gene encodes an essential regulator of mitochondrial Ca2+ uptake under basal conditions. The encoded protein interacts with the mitochondrial calcium uniporter, a mitochondrial inner membrane Ca2+ channel, and is essential in preventing mitochondrial Ca2+ overload, which can cause excessive production of reactive oxygen species and cell stress. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Mar 2013]

Uniprot Description

MICU1: Key regulator of mitochondrial calcium uptake required for calcium entry into mitochondrion. May act as a calcium sensor via its EF-hand domains, gating the activity of a calcium channel partner. Induces T-helper 1-mediated autoreactivity, which is accompanied by the release of IFNG. Belongs to the MICU1 family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Mitochondrial; Calcium-binding

Chromosomal Location of Human Ortholog: 10q22.1

Cellular Component: mitochondrion; mitochondrial inner membrane; mitochondrial intermembrane space; intracellular

Molecular Function: identical protein binding; protein binding; protein heterodimerization activity; calcium ion binding

Biological Process: mitochondrial calcium ion homeostasis; defense response; mitochondrial calcium ion transport; protein homooligomerization; elevation of mitochondrial calcium ion concentration

Disease: Myopathy With Extrapyramidal Signs

Research Articles on MICU1

Similar Products

Product Notes

The MICU1 micu1 (Catalog #AAA3217226) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MICU1 Antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MICU1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MICU1 micu1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LSDHVCDVVF ALFDCDGNGE LSNKEFVSIM KQRLMRGLEK PKDMGFTRLM. It is sometimes possible for the material contained within the vial of "MICU1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.