Western Blot (WB)
(Host: RabbitTarget Name: CD1CSample Type: THP-1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit anti-Human, Rat CD1C Polyclonal Antibody | anti-CD1C antibody
CD1C Antibody - C-terminal region
Gene Names
CD1C; R7; CD1; CD1A; BDCA1
Reactivity
Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CD1C; Polyclonal Antibody; CD1C Antibody - C-terminal region; anti-CD1C antibody
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ASGFYPKPVWVTWMRNEQEQLGTKHGDILPNADGTWYLQVILEVASEEPA
Sequence Length
333
Applicable Applications for anti-CD1C antibody
Western Blot (WB)
Homology
Human: 100%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human CD1C
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: CD1CSample Type: THP-1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: CD1CSample Type: THP-1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-CD1C antibody
This is a rabbit polyclonal antibody against CD1C. It was validated on Western Blot
Target Description: This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene is broadly distributed throughout the endocytic system via a tyrosine-based motif in the cytoplasmic tail. Alternatively spliced transcript variants of this gene have been observed, but their full-length nature is not known.
Target Description: This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene is broadly distributed throughout the endocytic system via a tyrosine-based motif in the cytoplasmic tail. Alternatively spliced transcript variants of this gene have been observed, but their full-length nature is not known.
Product Categories/Family for anti-CD1C antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35kDa
NCBI Official Full Name
T-cell surface glycoprotein CD1c
NCBI Official Synonym Full Names
CD1c molecule
NCBI Official Symbol
CD1C
NCBI Official Synonym Symbols
R7; CD1; CD1A; BDCA1
NCBI Protein Information
T-cell surface glycoprotein CD1c
UniProt Protein Name
T-cell surface glycoprotein CD1c
Protein Family
UniProt Gene Name
CD1C
UniProt Entry Name
CD1C_HUMAN
NCBI Description
This gene encodes a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene is broadly distributed throughout the endocytic system via a tyrosine-based motif in the cytoplasmic tail. Alternatively spliced transcript variants of this gene have been observed, but their full-length nature is not known. [provided by RefSeq, Jul 2008]
Research Articles on CD1C
Similar Products
Product Notes
The CD1C cd1c (Catalog #AAA3215991) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CD1C Antibody - C-terminal region reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CD1C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CD1C cd1c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ASGFYPKPVW VTWMRNEQEQ LGTKHGDILP NADGTWYLQV ILEVASEEPA. It is sometimes possible for the material contained within the vial of "CD1C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
