Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MGLL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: ACHN cell lysateMGLL is supported by BioGPS gene expression data to be expressed in ACHN)

Rabbit MGLL Polyclonal Antibody | anti-MGLL antibody

MGLL antibody - N-terminal region

Gene Names
MGLL; MGL; HUK5; MAGL; HU-K5
Reactivity
Dog, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MGLL; Polyclonal Antibody; MGLL antibody - N-terminal region; anti-MGLL antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: METGPEDPSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGT
Sequence Length
313
Applicable Applications for anti-MGLL antibody
Western Blot (WB)
Homology
Dog: 93%; Human: 100%; Mouse: 79%; Pig: 86%; Rabbit: 93%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MGLL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MGLL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: ACHN cell lysateMGLL is supported by BioGPS gene expression data to be expressed in ACHN)

Western Blot (WB) (WB Suggested Anti-MGLL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: ACHN cell lysateMGLL is supported by BioGPS gene expression data to be expressed in ACHN)
Related Product Information for anti-MGLL antibody
This is a rabbit polyclonal antibody against MGLL. It was validated on Western Blot

Target Description: Monoglyceride lipase (MGLL; EC 3.1.1.23) functions together with hormone-sensitive lipase (LIPE; MIM 151750) to hydrolyze intracellular triglyceride stores in adipocytes and other cells to fatty acids and glycerol. MGLL may also complement lipoprotein lipase (LPL; MIM 238600) in completing hydrolysis of monoglycerides resulting from degradation of lipoprotein triglycerides (Karlsson et al., 2001 [PubMed 11470505]).
Product Categories/Family for anti-MGLL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
monoglyceride lipase isoform 1
NCBI Official Synonym Full Names
monoglyceride lipase
NCBI Official Symbol
MGLL
NCBI Official Synonym Symbols
MGL; HUK5; MAGL; HU-K5
NCBI Protein Information
monoglyceride lipase
UniProt Protein Name
Monoglyceride lipase
Protein Family
UniProt Gene Name
MGLL
UniProt Synonym Gene Names
MAGL
UniProt Entry Name
MGLL_HUMAN

NCBI Description

This gene encodes a serine hydrolase of the AB hydrolase superfamily that catalyzes the conversion of monoacylglycerides to free fatty acids and glycerol. The encoded protein plays a critical role in several physiological processes including pain and nociperception through hydrolysis of the endocannabinoid 2-arachidonoylglycerol. Expression of this gene may play a role in cancer tumorigenesis and metastasis. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Feb 2012]

Uniprot Description

MGLL: Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain. Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth. Belongs to the AB hydrolase superfamily. Monoacylglycerol lipase family.

Protein type: Lipid Metabolism - glycerolipid; EC 3.1.1.23; Phospholipase

Chromosomal Location of Human Ortholog: 3q21.3

Cellular Component: cytosol; endoplasmic reticulum membrane; extrinsic to membrane; membrane; nucleoplasm; plasma membrane

Molecular Function: acylglycerol lipase activity; lysophospholipase activity; protein homodimerization activity

Biological Process: acylglycerol catabolic process; arachidonic acid metabolic process; blood coagulation; fatty acid biosynthetic process; glycerophospholipid biosynthetic process; inflammatory response; lipid metabolic process; phospholipid metabolic process; platelet activation; regulation of inflammatory response; regulation of sensory perception of pain; regulation of signal transduction; triacylglycerol catabolic process

Research Articles on MGLL

Similar Products

Product Notes

The MGLL mgll (Catalog #AAA3210730) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MGLL antibody - N-terminal region reacts with Dog, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MGLL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MGLL mgll for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: METGPEDPSS MPEESSPRRT PQSIPYQDLP HLVNADGQYL FCRYWKPTGT. It is sometimes possible for the material contained within the vial of "MGLL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.