Immunohistochemistry (IHC)
(Sample Type :mouse tracheal epithelial cellsPrimary Antibody Dilution :1:50Secondary Antibody :Anti-rabbit alexa 488Secondary Antibody Dilution :1:1000Gene Name :DNAH9Submitted by :Lee, Yin Loon)
Rabbit DNAH9 Polyclonal Antibody | anti-DNAH9 antibody
DNAH9 Antibody - C-terminal region
Gene Names
DNAH9; DYH9; HL20; DNEL1; HL-20; CILD40; Dnahc9; DNAH17L
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
DNAH9; Polyclonal Antibody; DNAH9 Antibody - C-terminal region; anti-DNAH9 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DSQARDGAGATREEKVKALLEEILERVTDEFNIPELMAKVEERTPYIVVA
Sequence Length
798
Applicable Applications for anti-DNAH9 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 83%; Dog: 100%; Guinea Pig: 83%; Horse: 92%; Human: 100%; Mouse: 92%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human DNAH9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Sample Type :mouse tracheal epithelial cellsPrimary Antibody Dilution :1:50Secondary Antibody :Anti-rabbit alexa 488Secondary Antibody Dilution :1:1000Gene Name :DNAH9Submitted by :Lee, Yin Loon)
Immunohistochemistry (IHC)
(Sample Type :mouse tracheal epithelial cellsPrimary Antibody Dilution :1:50Secondary Antibody :Anti-rabbit alexa 488Secondary Antibody Dilution :1:1000Gene Name :DNAH9Submitted by :Lee, Yin Loon)
Immunohistochemistry (IHC)
(Sample Type :mouse tracheal epithelial cellsPrimary Antibody Dilution :1:50Secondary Antibody :Anti-rabbit alexa 488Secondary Antibody Dilution :1:1000Gene Name :DNAH9Submitted by :Lee, Yin Loon)
Immunohistochemistry (IHC)
(Sample Type :mouse tracheal epithelial cellsPrimary Antibody Dilution :1:50Secondary Antibody :Anti-rabbit alexa 488Secondary Antibody Dilution :1:1000Gene Name :DNAH9Submitted by :Lee, Yin Loon)
Western Blot (WB)
(WB Suggested Anti-DNAH9 AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)
Western Blot (WB)
(WB Suggested Anti-DNAH9 AntibodyTitration: 1.0 ug/mlPositive Control: Placenta)
Related Product Information for anti-DNAH9 antibody
This is a rabbit polyclonal antibody against DNAH9. It was validated on Western Blot
Target Description: This gene encodes the heavy chain subunit of axonemal dynein, a large multi-subunit molecular motor. Axonemal dynein attaches to microtubules and hydrolyzes ATP to mediate the movement of cilia and flagella. The gene expresses at least two transcript variants; additional variants have been described, but their full length nature has not been determined.
Target Description: This gene encodes the heavy chain subunit of axonemal dynein, a large multi-subunit molecular motor. Axonemal dynein attaches to microtubules and hydrolyzes ATP to mediate the movement of cilia and flagella. The gene expresses at least two transcript variants; additional variants have been described, but their full length nature has not been determined.
Product Categories/Family for anti-DNAH9 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
91kDa
NCBI Official Full Name
dynein heavy chain 9, axonemal isoform 1
NCBI Official Synonym Full Names
dynein axonemal heavy chain 9
NCBI Official Symbol
DNAH9
NCBI Official Synonym Symbols
DYH9; HL20; DNEL1; HL-20; CILD40; Dnahc9; DNAH17L
NCBI Protein Information
dynein heavy chain 9, axonemal
Protein Family
NCBI Description
This gene encodes the heavy chain subunit of axonemal dynein, a large multi-subunit molecular motor. Axonemal dynein attaches to microtubules and hydrolyzes ATP to mediate the movement of cilia and flagella. The gene expresses at least two transcript variants; additional variants have been described, but their full length nature has not been determined. [provided by RefSeq, Jul 2008]
Research Articles on DNAH9
Similar Products
Product Notes
The DNAH9 (Catalog #AAA3216894) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DNAH9 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DNAH9 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the DNAH9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DSQARDGAGA TREEKVKALL EEILERVTDE FNIPELMAKV EERTPYIVVA. It is sometimes possible for the material contained within the vial of "DNAH9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
