Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-C11orf73 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: ACHN cell lysate)

Rabbit HIKESHI Polyclonal Antibody | anti-HIKESHI antibody

HIKESHI Antibody - middle region

Gene Names
HIKESHI; HLD13; L7RN6; OPI10; HSPC138; HSPC179; C11orf73
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
HIKESHI; Polyclonal Antibody; HIKESHI Antibody - middle region; anti-HIKESHI antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DNFYNFASSFAVSQAQMTPSPSEMFIPANVVLKWYENFQRRLAQNPLFWK
Sequence Length
197
Applicable Applications for anti-HIKESHI antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 90%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 93%; Rat: 100%; Yeast: 90%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human C11orf73
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-C11orf73 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: ACHN cell lysate)

Western Blot (WB) (WB Suggested Anti-C11orf73 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: ACHN cell lysate)
Related Product Information for anti-HIKESHI antibody
This is a rabbit polyclonal antibody against C11orf73. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes an evolutionarily conserved nuclear transport receptor that mediates heat-shock-induced nuclear import of 70 kDa heat-shock proteins (Hsp70s) through interactions with FG-nucleoporins. The protein mediates transport of the ATP form but not the ADP form of Hsp70 proteins under conditions of heat shock stress. Structural analyses demonstrate that the protein forms an asymmetric homodimer and that the N-terminal domain consists of a jelly-roll/beta-sandwich fold structure that contains hydrophobic pockets involved in FG-nucleoporin recognition. Reduction of RNA expression levels in HeLa cells using small interfering RNAs results in inhibition of heat shock-induced nuclear accumulation of Hsp70s, indicating a role for this gene in regulation of Hsp70 nuclear import during heat shock stress.
Product Categories/Family for anti-HIKESHI antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
21kDa
NCBI Official Full Name
protein Hikeshi isoform 1
NCBI Official Synonym Full Names
Hikeshi, heat shock protein nuclear import factor
NCBI Official Symbol
HIKESHI
NCBI Official Synonym Symbols
HLD13; L7RN6; OPI10; HSPC138; HSPC179; C11orf73
NCBI Protein Information
protein Hikeshi
UniProt Protein Name
Protein Hikeshi
Protein Family
UniProt Gene Name
C11orf73
UniProt Entry Name
HIKES_HUMAN

NCBI Description

This gene encodes an evolutionarily conserved nuclear transport receptor that mediates heat-shock-induced nuclear import of 70 kDa heat-shock proteins (Hsp70s) through interactions with FG-nucleoporins. The protein mediates transport of the ATP form but not the ADP form of Hsp70 proteins under conditions of heat shock stress. Structural analyses demonstrate that the protein forms an asymmetric homodimer and that the N-terminal domain consists of a jelly-roll/beta-sandwich fold structure that contains hydrophobic pockets involved in FG-nucleoporin recognition. Reduction of RNA expression levels in HeLa cells using small interfering RNAs results in inhibition of heat shock-induced nuclear accumulation of Hsp70s, indicating a role for this gene in regulation of Hsp70 nuclear import during heat shock stress. [provided by RefSeq, Apr 2016]

Uniprot Description

C11orf73: Acts as a specific nuclear import carrier for HSP70 proteins following heat-shock stress: acts by mediating the nucleoporin-dependent translocation of ATP-bound HSP70 proteins into the nucleus. HSP70 proteins import is required to protect cells from heat shock damages. Does not translocate ADP-bound HSP70 proteins into the nucleus

Protein type: Cell development/differentiation

Chromosomal Location of Human Ortholog: 11q14.2

Cellular Component: intracellular; cell junction; cytosol; nucleus

Molecular Function: Hsp70 protein binding; protein transporter activity

Biological Process: protein transport; protein import into nucleus; Golgi organization and biogenesis; lung development

Research Articles on HIKESHI

Similar Products

Product Notes

The HIKESHI c11orf73 (Catalog #AAA3213068) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The HIKESHI Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's HIKESHI can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HIKESHI c11orf73 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DNFYNFASSF AVSQAQMTPS PSEMFIPANV VLKWYENFQR RLAQNPLFWK. It is sometimes possible for the material contained within the vial of "HIKESHI, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.