Rabbit anti-Human MGAT5 Polyclonal Antibody | anti-MGAT5 antibody

MGAT5 Antibody - C-terminal region

Cat. Num. AAA3207709

• Gene Names: MGAT5; GNT-V; GNT-VA; MGAT5A
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: MGAT5; Polyclonal Antibody; MGAT5 Antibody - C-terminal region; anti-MGAT5 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: GCAFLNPKFNPPKSSKNTDFFIGKPTLRELTSQHPYAEVFIGRPHVWTVD
• Sequence Length: 741

• Applicable Applications for anti-MGAT5 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MGAT5
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MGAT5Sample Type: OVCAR-3 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Related Product Information for anti-MGAT5 antibody

This is a rabbit polyclonal antibody against MGAT5. It was validated on Western Blot

Target Description: The protein encoded by this gene belongs to the glycosyltransferase family. It catalyzes the addition of beta-1,6-N-acetylglucosamine to the alpha-linked mannose of biantennary N-linked oligosaccharides present on the newly synthesized glycoproteins. It is one of the most important enzymes involved in the regulation of the biosynthesis of glycoprotein oligosaccharides. Alterations of the oligosaccharides on cell surface glycoproteins cause significant changes in the adhesive or migratory behavior of a cell. Increase in the activity of this enzyme has been correlated with the progression of invasive malignancies.

Product Categories/Family for anti-MGAT5 antibody

Polyclonal; Cancer; Cell Adhesion; Disease Related

NCBI and Uniprot Product Information

• NCBI GI #: 530369202
• NCBI GeneID: 4249
• NCBI Accession #: XP_005263727
• NCBI GenBank Nucleotide #: XM_005263670.3
• UniProt Accession #: Q09328
• Molecular Weight: 81kDa
• NCBI Official Full Name: alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A isoform X1
• NCBI Official Synonym Full Names: alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase
• NCBI Official Symbol: MGAT5
• NCBI Official Synonym Symbols: GNT-V; GNT-VA; MGAT5A
• NCBI Protein Information: alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A
• UniProt Protein Name: Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase A
• Protein Family: Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase
• UniProt Gene Name: MGAT5
• UniProt Synonym Gene Names: GGNT5; GNT-V

NCBI Description

The protein encoded by this gene belongs to the glycosyltransferase family. It catalyzes the addition of beta-1,6-N-acetylglucosamine to the alpha-linked mannose of biantennary N-linked oligosaccharides present on the newly synthesized glycoproteins. It is one of the most important enzymes involved in the regulation of the biosynthesis of glycoprotein oligosaccharides. Alterations of the oligosaccharides on cell surface glycoproteins cause significant changes in the adhesive or migratory behavior of a cell. Increase in the activity of this enzyme has been correlated with the progression of invasive malignancies. [provided by RefSeq, Oct 2011]

Uniprot Description

Catalyzes the addition of N-acetylglucosamine in beta 1-6 linkage to the alpha-linked mannose of biantennary N-linked oligosaccharides. It is one of the most important enzymes involved in the regulation of the biosynthesis of glycoprotein oligosaccharides.