anti-Human MGA Polyclonal Antibody | anti-MGA antibody

Anti-MGA Antibody

Cat. Num. AAA178030

• Gene Names: MGA; MAD5; MXD5
• Reactivity: Human
• Applications: Western Blot
• Purity: Immunogen Affinity Purified
• Synonyms: MGA; Polyclonal Antibody; Anti-MGA Antibody; MAX gene-associated protein; MAD5; MAX dimerization protein 5; MAX gene associated; MAX gene associated protein; Max interacting protein; MGAM; MXD5; MAX dimerization protein; anti-MGA antibody

• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 2856

• Applicable Applications for anti-MGA antibody: Western Blot (WB)
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human MGA (2376-2415aa QKEAEAFAYYRRTHTANERRRRGEMRDLFEKLKITLGLLH), different from the related mouse sequence by two amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of MGA expression in HELA whole cell lysates (lane 1), MCF-7 whole cell lysates (lane 2) and SW620 whole cell lysates (lane 3). MGA at 334KD was detected using rabbit anti- MGA Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Related Product Information for anti-MGA antibody

Description: Rabbit IgG polyclonal antibody for MAX gene-associated protein(MGA) detection. Tested with WB in Human.

Background: Mga is a DNA-binding protein that activates the expression of several important virulence genes in Streptococcus pyogenes (group A Streptococcus, GAS) in response to changing environmental conditions. It had been found that the mouse transcription factor Max interacted with Mga. Coimmunoprecipitation analysis confirmed that Max and Mga interacted in transfected HEK293 cells. EMSA revealed that Mga required Max for binding to the E-box sequence CACGTG. The isolated T-box of Mga bound the brachyury T-box-binding site in the absence of Max. Mga repressed transcription of a reporter driven from a T-box-binding site, but coexpression of Mga with Max caused transcriptional activation from the T-box-binding site. Expression of Mga with Max, but not Mga alone, activated transcription from a reporter containing the E-box site.

References

1. Hurlin, P. J., Steingrimsson, E., Copeland, N. G., Jenkins, N. A., Eisenman, R. N. Mga, a dual-specificity transcription factor that interacts with Max and contains a T-domain DNA-binding motif. EMBO J. 18: 7019-7028, 1999. Note: Erratum: EMBO J. 19: 3841 only, 2000. 2. McIver KS, Myles RL (March 2002). "Two DNA-binding domains of Mga are required for virulence gene activation in the group A streptococcus". Mol. Microbiol. 43 (6): 1591-601.

NCBI and Uniprot Product Information

• NCBI GI #: 256017159
• NCBI GeneID: 23269
• NCBI Accession #: NP_001074010.2
• NCBI GenBank Nucleotide #: NM_001080541.2
• UniProt Accession #: Q8IWI9; Q9H8R3; Q9H9N7; Q9UG69; Q9Y4E9; E7ENI0; F5H7K2
• Molecular Weight: 336,159 Da
• NCBI Official Full Name: MAX gene-associated protein isoform 2
• NCBI Official Synonym Full Names: MGA, MAX dimerization protein
• NCBI Official Symbol: MGA
• NCBI Official Synonym Symbols: MAD5; MXD5
• NCBI Protein Information: MAX gene-associated protein
• UniProt Protein Name: MAX gene-associated protein
• Protein Family: MAX gene-associated protein
• UniProt Gene Name: MGA
• UniProt Synonym Gene Names: KIAA0518; MAD5
• UniProt Entry Name: MGAP_HUMAN

Uniprot Description

Functions as a dual-specificity transcription factor, regulating the expression of both MAX-network and T-box family target genes. Functions as a repressor or an activator. Binds to 5'-AATTTCACACCTAGGTGTGAAATT-3' core sequence and seems to regulate MYC-MAX target genes. Suppresses transcriptional activation by MYC and inhibits MYC-dependent cell transformation. Function activated by heterodimerization with MAX. This heterodimerization serves the dual function of both generating an E-box-binding heterodimer and simultaneously blocking interaction of a corepressor ().