Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of VRK1 expression in rat thymus extract (lane 1) and JURKAT whole cell lysates (lane 2). VRK1 at 55KD was detected using rabbit anti- VRK1 Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

anti-Human, Rat VRK1 Polyclonal Antibody | anti-VRK1 antibody

Anti-VRK1 Antibody

Gene Names
VRK1; PCH1; PCH1A
Reactivity
Human, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
VRK1; Polyclonal Antibody; Anti-VRK1 Antibody; Serine/threonine-protein kinase VRK1; MGC117401; MGC138280; MGC142070; PCH1; PCH1A; Serine/threonine protein kinase VRK1; Vaccinia related kinase 1; Vaccinia virus B1R related kinase 1; Vaccinia-related kinase 1; VRK1_HUMAN; vaccinia related kinase 1; anti-VRK1 antibody
Ordering
For Research Use Only!
Reactivity
Human, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
396
Applicable Applications for anti-VRK1 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human VRK1 (292-329aa EKNKPGEIAKYMETVKLLDYTEKPLYENLRDILLQGLK), different from the related mouse sequence by three amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of VRK1 expression in rat thymus extract (lane 1) and JURKAT whole cell lysates (lane 2). VRK1 at 55KD was detected using rabbit anti- VRK1 Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of VRK1 expression in rat thymus extract (lane 1) and JURKAT whole cell lysates (lane 2). VRK1 at 55KD was detected using rabbit anti- VRK1 Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-VRK1 antibody
Description: Rabbit IgG polyclonal antibody for Serine/threonine-protein kinase VRK1(VRK1) detection. Tested with WB in Human;Rat.

Background: Serine/threonine-protein kinase VRK1 is an enzyme that in humans is encoded by the VRK1 gene. This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. It is widely expressed in human tissues and has increased expression in actively dividing cells, such as those in testis, thymus, fetal liver, and carcinomas. Its protein localizes to the nucleus and has been shown to promote the stability and nuclear accumulation of a transcriptionally active p53 molecule and, in vitro, to phosphorylate Thr18 of p53 and reduce p53 ubiquitination. This gene, therefore, may regulate cell proliferation. This protein also phosphorylates histone, casein, and the transcription factors ATF2 (activating transcription factor 2) and c-JUN.
References
1. "Entrez Gene: VRK1 vaccinia related kinase 1". 2. Nezu J, Oku A, Jones MH, Shimane M (Feb 1998). "Identification of two novel human putative serine/threonine kinases, VRK1 and VRK2, with structural similarity to vaccinia virus B1R kinase". Genomics 45 (2): 327-31.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45,476 Da
NCBI Official Full Name
serine/threonine-protein kinase VRK1
NCBI Official Synonym Full Names
vaccinia related kinase 1
NCBI Official Symbol
VRK1
NCBI Official Synonym Symbols
PCH1; PCH1A
NCBI Protein Information
serine/threonine-protein kinase VRK1
UniProt Protein Name
Serine/threonine-protein kinase VRK1
UniProt Gene Name
VRK1
UniProt Entry Name
VRK1_HUMAN

NCBI Description

This gene encodes a member of the vaccinia-related kinase (VRK) family of serine/threonine protein kinases. This gene is widely expressed in human tissues and has increased expression in actively dividing cells, such as those in testis, thymus, fetal liver, and carcinomas. Its protein localizes to the nucleus and has been shown to promote the stability and nuclear accumulation of a transcriptionally active p53 molecule and, in vitro, to phosphorylate Thr18 of p53 and reduce p53 ubiquitination. This gene, therefore, may regulate cell proliferation. This protein also phosphorylates histone, casein, and the transcription factors ATF2 (activating transcription factor 2) and c-JUN. [provided by RefSeq, Jul 2008]

Uniprot Description

VRK1: Serine/threonine kinase that phosphorylates Thr-18 of p53/TP53 and may thereby prevent the interaction between p53/TP53 and MDM2. Defects in VRK1 are the cause of pontocerebellar hypoplasia type 1 (PCH1); also called pontocerebellar hypoplasia with infantile spinal muscular atrophy or pontocerebellar hypoplasia with anterior horn cell disease. PCH1 is characterized by an abnormally small cerebellum and brainstem, central and peripheral motor dysfunction from birth, gliosis and anterior horn cell degeneration resembling infantile spinal muscular atrophy (SMA). Belongs to the protein kinase superfamily. CK1 Ser/Thr protein kinase family. VRK subfamily.

Protein type: Protein kinase, CK1; Kinase, protein; EC 2.7.11.1; Protein kinase, Ser/Thr (non-receptor); CK1 group; VRK family

Chromosomal Location of Human Ortholog: 14q32

Cellular Component: cytoplasm; cytosol; Golgi stack; nucleolus; nucleoplasm; nucleus; spindle

Molecular Function: ATP binding; histone serine kinase activity (H3-S10 specific); nucleosomal histone binding; protein binding; protein kinase activity; protein kinase binding; protein serine/threonine kinase activity

Biological Process: cell division; mitosis; mitotic nuclear envelope disassembly; mitotic nuclear envelope reassembly; protein amino acid autophosphorylation; protein amino acid phosphorylation; regulation of cell shape

Disease: Pontocerebellar Hypoplasia, Type 1a

Research Articles on VRK1

Similar Products

Product Notes

The VRK1 vrk1 (Catalog #AAA178115) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-VRK1 Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's VRK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the VRK1 vrk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "VRK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.