Western Blot (WB)
(Host: RabbitTarget Name: MGASample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/mlMGA is supported by BioGPS gene expression data to be expressed in 721_B)
Rabbit MGA Polyclonal Antibody | anti-MGA antibody
MGA Antibody - C-terminal region
Gene Names
MGA; MAD5; MXD5
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MGA; Polyclonal Antibody; MGA Antibody - C-terminal region; anti-MGA antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ASLQMKRESQNPDQKDETNSIKREQETKKVLQSEGEAVDPEANVIKQNSG
Sequence Length
697
Applicable Applications for anti-MGA antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 85%; Horse: 92%; Human: 100%; Mouse: 79%; Pig: 92%; Rabbit: 79%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MGA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: MGASample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/mlMGA is supported by BioGPS gene expression data to be expressed in 721_B)
Western Blot (WB)
(Host: RabbitTarget Name: MGASample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/mlMGA is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-MGA antibody
This is a rabbit polyclonal antibody against MGA. It was validated on Western Blot
Target Description: MGA functions as a dual-specificity transcription factor, regulating the expression of both MAX-network and T-box family target genes and functions as a repressor or an activator. It binds to 5'-AATTTCACACCTAGGTGTGAAATT-3' core sequence and seems to regulate MYC-MAX target genes. It suppresses transcriptional activation by MYC and inhibits MYC-dependent cell transformation. It function activated by heterodimerization with MAX. This heterodimerization serves the dual function of both generating an E-box-binding heterodimer and simultaneously blocking interaction of a corepressor
Target Description: MGA functions as a dual-specificity transcription factor, regulating the expression of both MAX-network and T-box family target genes and functions as a repressor or an activator. It binds to 5'-AATTTCACACCTAGGTGTGAAATT-3' core sequence and seems to regulate MYC-MAX target genes. It suppresses transcriptional activation by MYC and inhibits MYC-dependent cell transformation. It function activated by heterodimerization with MAX. This heterodimerization serves the dual function of both generating an E-box-binding heterodimer and simultaneously blocking interaction of a corepressor
Product Categories/Family for anti-MGA antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76kDa
NCBI Official Full Name
MAX gene-associated protein isoform 2
NCBI Official Synonym Full Names
MAX dimerization protein MGA
NCBI Official Symbol
MGA
NCBI Official Synonym Symbols
MAD5; MXD5
NCBI Protein Information
MAX gene-associated protein
UniProt Protein Name
MAX gene-associated protein
Protein Family
UniProt Gene Name
MGA
UniProt Synonym Gene Names
KIAA0518; MAD5
UniProt Entry Name
MGAP_HUMAN
Uniprot Description
Functions as a dual-specificity transcription factor, regulating the expression of both MAX-network and T-box family target genes. Functions as a repressor or an activator. Binds to 5'-AATTTCACACCTAGGTGTGAAATT-3' core sequence and seems to regulate MYC-MAX target genes. Suppresses transcriptional activation by MYC and inhibits MYC-dependent cell transformation. Function activated by heterodimerization with MAX. This heterodimerization serves the dual function of both generating an E-box-binding heterodimer and simultaneously blocking interaction of a corepressor ().
Research Articles on MGA
Similar Products
Product Notes
The MGA mga (Catalog #AAA3208631) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MGA Antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MGA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MGA mga for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ASLQMKRESQ NPDQKDETNS IKREQETKKV LQSEGEAVDP EANVIKQNSG. It is sometimes possible for the material contained within the vial of "MGA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
