Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MEPESample Tissue: Human Uterus Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human MEPE Polyclonal Antibody | anti-MEPE antibody

MEPE Antibody - C-terminal region

Gene Names
MEPE; OF45
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MEPE; Polyclonal Antibody; MEPE Antibody - C-terminal region; anti-MEPE antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VPHRQNNSTRNKGMPQGKGSWGRQPHSNRRFSSRRRDDSSESSDSGSSSE
Sequence Length
412
Applicable Applications for anti-MEPE antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human MEPE
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MEPESample Tissue: Human Uterus Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MEPESample Tissue: Human Uterus Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-MEPE antibody
This gene encodes a secreted calcium-binding phosphoprotein that belongs to the small integrin-binding ligand, N-linked glycoprotein (SIBLING) family of proteins. Members of this family are components of the extracellular matrix of bone and dentin and regulate bone mineralization. Deficiency of a similar protein in mouse results in increased bone mass. Mice lacking this gene are resistant to aging-related trabecular bone loss. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-MEPE antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45 kDa
NCBI Official Full Name
matrix extracellular phosphoglycoprotein isoform a
NCBI Official Synonym Full Names
matrix extracellular phosphoglycoprotein
NCBI Official Symbol
MEPE
NCBI Official Synonym Symbols
OF45
NCBI Protein Information
matrix extracellular phosphoglycoprotein
UniProt Protein Name
Matrix extracellular phosphoglycoprotein
UniProt Gene Name
MEPE
UniProt Synonym Gene Names
OF45
UniProt Entry Name
MEPE_HUMAN

NCBI Description

This gene encodes a secreted calcium-binding phosphoprotein that belongs to the small integrin-binding ligand, N-linked glycoprotein (SIBLING) family of proteins. Members of this family are components of the extracellular matrix of bone and dentin and regulate bone mineralization. Deficiency of a similar protein in mouse results in increased bone mass. Mice lacking this gene are resistant to aging-related trabecular bone loss. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2014]

Uniprot Description

MEPE: Promotes renal phosphate excretion and modulates mineralization. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 4q21.1

Cellular Component: proteinaceous extracellular matrix

Molecular Function: protein binding; extracellular matrix structural constituent

Biological Process: negative regulation of bone mineralization; biomineral formation; regulation of bone remodeling; skeletal development

Research Articles on MEPE

Similar Products

Product Notes

The MEPE mepe (Catalog #AAA3221578) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MEPE Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MEPE can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MEPE mepe for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VPHRQNNSTR NKGMPQGKGS WGRQPHSNRR FSSRRRDDSS ESSDSGSSSE. It is sometimes possible for the material contained within the vial of "MEPE, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.