Western Blot (WB)
(WB Suggested Anti-Memo1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Kidney)
Rabbit Memo1 Polyclonal Antibody | anti-MEMO1 antibody
Memo1 antibody - middle region
Gene Names
Memo1; 0610016J10Rik; D930048L02Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Memo1; Polyclonal Antibody; Memo1 antibody - middle region; anti-MEMO1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: CHWGQRFRYSYYDESQGEIYRSIEHLDKMGMSIIEQLDPVSFSNYLKKYH
Sequence Length
297
Applicable Applications for anti-MEMO1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 86%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Memo1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Kidney)
Western Blot (WB)
(WB Suggested Anti-Memo1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Kidney)
Related Product Information for anti-MEMO1 antibody
This is a rabbit polyclonal antibody against Memo1. It was validated on Western Blot
Target Description: Memo1 may control cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton. It is a mediator of ERBB2 signaling. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity. In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization.
Target Description: Memo1 may control cell migration by relaying extracellular chemotactic signals to the microtubule cytoskeleton. It is a mediator of ERBB2 signaling. The MEMO1-RHOA-DIAPH1 signaling pathway plays an important role in ERBB2-dependent stabilization of microtubules at the cell cortex. It controls the localization of APC and CLASP2 to the cell membrane, via the regulation of GSK3B activity. In turn, membrane-bound APC allows the localization of the MACF1 to the cell membrane, which is required for microtubule capture and stabilization.
Product Categories/Family for anti-MEMO1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
protein MEMO1
NCBI Official Synonym Full Names
mediator of cell motility 1
NCBI Official Symbol
Memo1
NCBI Official Synonym Symbols
0610016J10Rik; D930048L02Rik
NCBI Protein Information
protein MEMO1
UniProt Protein Name
Protein MEMO1
Protein Family
UniProt Gene Name
Memo1
UniProt Synonym Gene Names
Memo-1
UniProt Entry Name
MEMO1_MOUSE
Research Articles on MEMO1
Similar Products
Product Notes
The MEMO1 memo1 (Catalog #AAA3207985) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Memo1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Memo1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MEMO1 memo1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: CHWGQRFRYS YYDESQGEIY RSIEHLDKMG MSIIEQLDPV SFSNYLKKYH. It is sometimes possible for the material contained within the vial of "Memo1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
