anti-Human, Mouse MDMX Polyclonal Antibody | anti-MDMX antibody

Anti-MDMX Antibody

Cat. Num. AAA177880

• Gene Names: MDM4; HDMX; MDMX; MRP1
• Reactivity: Human, Mouse
• Applications: Western Blot, Immunohistochemistry
• Purity: Immunogen Affinity Purified
• Synonyms: MDMX; Polyclonal Antibody; Anti-MDMX Antibody; Protein Mdm4; DKFZp781B1423; Double minute 4; Double minute 4 human homolog of p53 binding protein; Double minute 4 protein; HDMX; MDM 4; Mdm2 like p53 binding protein; Mdm2-like p53-binding protein; MDM4; Mdm4 p53 binding protein homolog mouse; Mdm4 protein; MDM4 related protein 1; Mdm4 transformed 3T3 cell double minute 4; Mdm4 transformed 3T3 cell double minute 4 p53 binding protein; Mdm4 transformed 3T3 cell double minute 4 p53 binding protein mouse; MDM4_HUMAN; Mdmx protein; MGC132766; Mouse double minute 4 homolog; Mouse double minute 4 human homolog of p53 binding protein; MRP 1; MRP1; p53 binding protein; p53 BINDING PROTEIN MDM4; p53-binding protein Mdm4; Protein Mdmx; p53 regulator; anti-MDMX antibody

• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 440

• Applicable Applications for anti-MDMX antibody: Western Blot (WB), Immunohistochemistry (IHC) Paraffin
• Application Notes: Western Blot Concentration: 0.1-0.5ug/ml; Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
• Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human MDMX (35-72aa KILHAAGAQGEMFTVKEVMHYLGQYIMVKQLYDQQEQH), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.
• Ig Type: Rabbit IgG
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Preparation and Storage: At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of MDMX expression in mouse testis extract (lane 1) and 22RV1 whole cell lysates (lane 2). MDMX at75KD was detected using rabbit anti- MDMX Antigen Affinity purified polyclonal antibody at0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Immunohistochemistry (IHC)

(MDMX was detected in paraffin-embedded sections of human lung cancer tissues using rabbit anti- MDMX Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method. )

Related Product Information for anti-MDMX antibody

Description: Rabbit IgG polyclonal antibody for Protein Mdm4(MDM4) detection. Tested with WB, IHC-P in Human;Mouse.

Background: Protein Mdm4 is a protein that in humans is encoded by the MDM4 gene. This gene encodes a nuclear protein that contains a p53 binding domain at the N-terminus and a RING finger domain at the C-terminus, and shows structural similarity to p53-binding protein MDM2. Both proteins bind the p53 tumor suppressor protein and inhibit its activity, and have been shown to be overexpressed in a variety of human cancers. However, unlike MDM2 which degrades p53, this protein inhibits p53 by binding its transcriptional activation domain. This protein also interacts with MDM2 protein via the RING finger domain, and inhibits the latter's degradation. So this protein can reverse MDM2-targeted degradation of p53, while maintaining suppression of p53 transactivation and apoptotic functions. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. 

References

1. "Entrez Gene: MDM4 Mdm4, transformed 3T3 cell double minute 4, p53 binding protein (mouse)". 2. Kadakia M, Brown TL, McGorry MM, Berberich SJ (Dec 2002). "MdmX inhibits Smad transactivation". Oncogene21 (57): 8776-85. 3. Shvarts A, Bazuine M, Dekker P, Ramos YF, Steegenga WT, Merckx G, van Ham RC, van der Houven van Oordt W, van der Eb AJ, Jochemsen AG (Sep 1997). "Isolation and identification of the human homolog of a new p53-binding protein, Mdmx". Genomics 43 (1): 34-42. 

NCBI and Uniprot Product Information

• NCBI GI #: 323510634
• NCBI GeneID: 4194
• NCBI Accession #: NP_001191100.1
• NCBI GenBank Nucleotide #: NM_001204171.1
• UniProt Accession #: O15151; Q2M2Y2; Q32SL2; Q6GS18; Q8IV83
• Molecular Weight: 49,541 Da
• NCBI Official Full Name: protein Mdm4 isoform 2
• NCBI Official Synonym Full Names: MDM4, p53 regulator
• NCBI Official Symbol: MDM4
• NCBI Official Synonym Symbols: HDMX; MDMX; MRP1
• NCBI Protein Information: protein Mdm4
• UniProt Protein Name: Protein Mdm4
• UniProt Gene Name: MDM4
• UniProt Synonym Gene Names: MDMX
• UniProt Entry Name: MDM4_HUMAN

NCBI Description

This gene encodes a nuclear protein that contains a p53 binding domain at the N-terminus and a RING finger domain at the C-terminus, and shows structural similarity to p53-binding protein MDM2. Both proteins bind the p53 tumor suppressor protein and inhibit its activity, and have been shown to be overexpressed in a variety of human cancers. However, unlike MDM2 which degrades p53, this protein inhibits p53 by binding its transcriptional activation domain. This protein also interacts with MDM2 protein via the RING finger domain, and inhibits the latter's degradation. So this protein can reverse MDM2-targeted degradation of p53, while maintaining suppression of p53 transactivation and apoptotic functions. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Feb 2011]

Uniprot Description

MDM4: Inhibits p53/TP53- and TP73/p73-mediated cell cycle arrest and apoptosis by binding its transcriptional activation domain. Inhibits degradation of MDM2. Can reverse MDM2-targeted degradation of TP53 while maintaining suppression of TP53 transactivation and apoptotic functions. Interacts with MDM2, TP53, TP73 and USP2. Found in a trimeric complex with UPB2, MDM2 and MDM4. Interacts (phosphorylated) with YWHAG; negatively regulates MDM4 activity toward TP53. Down-regulated by cisplatin. Expressed in all tissues tested with high levels in thymus. Belongs to the MDM2/MDM4 family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 6.3.2.-; Ubiquitin ligase; Ubiquitin conjugating system; Ligase

Chromosomal Location of Human Ortholog: 1q32

Cellular Component: nucleoplasm; nucleus

Molecular Function: enzyme binding; protein binding; zinc ion binding

Biological Process: cell proliferation; DNA damage response, signal transduction by p53 class mediator; DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest; G0 to G1 transition; negative regulation of apoptosis; negative regulation of cell proliferation; negative regulation of protein catabolic process; negative regulation of transcription from RNA polymerase II promoter; protein complex assembly; protein stabilization; protein ubiquitination