Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (MDH1 rabbit polyclonal antibody. Western Blot analysis of MDH1 expression in human spleen.)

Rabbit anti-Human MDH1 Polyclonal Antibody | anti-MDH1 antibody

MDH1 (Malate Dehydrogenase, Cytoplasmic, Cytosolic Malate Dehydrogenase, Diiodophenylpyruvate Reductase, MDHA) (AP)

Gene Names
MDH1; MDHA; MOR2; MDH-s; HEL-S-32; MGC:1375
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MDH1; Polyclonal Antibody; MDH1 (Malate Dehydrogenase; Cytoplasmic; Cytosolic Malate Dehydrogenase; Diiodophenylpyruvate Reductase; MDHA) (AP); anti-MDH1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MDH1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-MDH1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human MDH1, aa1-334 (NP_005908.1).
Immunogen Sequence
MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(MDH1 rabbit polyclonal antibody. Western Blot analysis of MDH1 expression in human spleen.)

Western Blot (WB) (MDH1 rabbit polyclonal antibody. Western Blot analysis of MDH1 expression in human spleen.)

Western Blot (WB)

(Western Blot analysis of MDH1 expression in transfected 293T cell line by MDH1 polyclonal antibody. Lane 1: MDH1 transfected lysate (36.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MDH1 expression in transfected 293T cell line by MDH1 polyclonal antibody. Lane 1: MDH1 transfected lysate (36.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-MDH1 antibody
MDH1 is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.
Product Categories/Family for anti-MDH1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38,628 Da
NCBI Official Full Name
malate dehydrogenase, cytoplasmic isoform 2
NCBI Official Synonym Full Names
malate dehydrogenase 1, NAD (soluble)
NCBI Official Symbol
MDH1
NCBI Official Synonym Symbols
MDHA; MOR2; MDH-s; HEL-S-32; MGC:1375
NCBI Protein Information
malate dehydrogenase, cytoplasmic; soluble malate dehydrogenase; cytosolic malate dehydrogenase; diiodophenylpyruvate reductase; epididymis secretory protein Li 32
UniProt Protein Name
Malate dehydrogenase, cytoplasmic
Protein Family
UniProt Gene Name
MDH1
UniProt Synonym Gene Names
MDHA
UniProt Entry Name
MDHC_HUMAN

NCBI Description

Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.[provided by RefSeq, Nov 2010]

Uniprot Description

MDH1: Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.[provided by RefSeq, Nov 2010]

Protein type: EC 1.1.1.96; Carbohydrate Metabolism - pyruvate; Oxidoreductase; Carbohydrate Metabolism - citrate (TCA) cycle; EC 1.1.1.37; Carbohydrate Metabolism - glyoxylate and dicarboxylate

Chromosomal Location of Human Ortholog: 2p13.3

Cellular Component: centrosome; extracellular space; mitochondrion; cytoplasm; cytosol

Molecular Function: malic enzyme activity; L-malate dehydrogenase activity; diiodophenylpyruvate reductase activity; NAD binding

Biological Process: malate metabolic process; oxaloacetate metabolic process; NADH metabolic process; tricarboxylic acid cycle; carbohydrate metabolic process; glucose metabolic process; cellular carbohydrate metabolic process; pathogenesis; gluconeogenesis

Research Articles on MDH1

Similar Products

Product Notes

The MDH1 mdh1 (Catalog #AAA6385137) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MDH1 (Malate Dehydrogenase, Cytoplasmic, Cytosolic Malate Dehydrogenase, Diiodophenylpyruvate Reductase, MDHA) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MDH1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MDH1 mdh1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MDH1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.