Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (MDH1 monoclonal antibody. Western Blot analysis of MDH1 expression in HeLa.)

Mouse anti-Human MDH1 Monoclonal Antibody | anti-MDH1 antibody

MDH1 (Malate Dehydrogenase, Cytoplasmic, Cytosolic Malate Dehydrogenase, Diiodophenylpyruvate Reductase, MDHA) (HRP)

Gene Names
MDH1; MDHA; MOR2; MDH-s; HEL-S-32; MGC:1375
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MDH1; Monoclonal Antibody; MDH1 (Malate Dehydrogenase; Cytoplasmic; Cytosolic Malate Dehydrogenase; Diiodophenylpyruvate Reductase; MDHA) (HRP); anti-MDH1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2B11-B7
Specificity
Recognizes human MDH1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-MDH1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-334 from human MDH1 (AAH01484.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSEPIRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLKDVIATDKEDVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAALDKYAKKSVKVIVVGNPANTNCLTASKSAPSIPKENFSCLTRLDHNRAKAQIALKLGVTANDVKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVIKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(MDH1 monoclonal antibody. Western Blot analysis of MDH1 expression in HeLa.)

Western Blot (WB) (MDH1 monoclonal antibody. Western Blot analysis of MDH1 expression in HeLa.)

Western Blot (WB)

(MDH1 monoclonal antibody. Western Blot analysis of MDH1 expression in HepG2.)

Western Blot (WB) (MDH1 monoclonal antibody. Western Blot analysis of MDH1 expression in HepG2.)

Western Blot (WB)

(MDH1 monoclonal antibody. Western Blot analysis of MDH1 expression in HL-60.)

Western Blot (WB) (MDH1 monoclonal antibody. Western Blot analysis of MDH1 expression in HL-60.)

Western Blot (WB)

(Western Blot analysis of MDH1 expression in transfected 293T cell line by MDH1 monoclonal antibody. Lane 1: MDH1 transfected lysate (36.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MDH1 expression in transfected 293T cell line by MDH1 monoclonal antibody. Lane 1: MDH1 transfected lysate (36.4kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged MDH1 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged MDH1 is ~3ng/ml as a capture antibody.)
Related Product Information for anti-MDH1 antibody
MDH1 is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria.
Product Categories/Family for anti-MDH1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
38,628 Da
NCBI Official Full Name
Homo sapiens malate dehydrogenase 1, NAD (soluble), mRNA
NCBI Official Synonym Full Names
malate dehydrogenase 1
NCBI Official Symbol
MDH1
NCBI Official Synonym Symbols
MDHA; MOR2; MDH-s; HEL-S-32; MGC:1375
NCBI Protein Information
malate dehydrogenase, cytoplasmic; malate dehydrogenase, peroxisomal
Protein Family

NCBI Description

This gene encodes an enzyme that catalyzes the NAD/NADH-dependent, reversible oxidation of malate to oxaloacetate in many metabolic pathways, including the citric acid cycle. Two main isozymes are known to exist in eukaryotic cells: one is found in the mitochondrial matrix and the other in the cytoplasm. This gene encodes the cytosolic isozyme, which plays a key role in the malate-aspartate shuttle that allows malate to pass through the mitochondrial membrane to be transformed into oxaloacetate for further cellular processes. Alternatively spliced transcript variants have been found for this gene. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is localized in the peroxisomes. Pseudogenes have been identified on chromosomes X and 6. [provided by RefSeq, Feb 2016]

Research Articles on MDH1

Similar Products

Product Notes

The MDH1 (Catalog #AAA6153474) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MDH1 (Malate Dehydrogenase, Cytoplasmic, Cytosolic Malate Dehydrogenase, Diiodophenylpyruvate Reductase, MDHA) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MDH1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MDH1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MDH1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.