Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: Mdh1Sample Type: Mouse Stomach lysatesAntibody Dilution: 1.0ug/ml)

Rabbit Mdh1 Polyclonal Antibody | anti-MDH1 antibody

Mdh1 Antibody - N-terminal region

Gene Names
Mdh1; MDHA; Mor2; MDH-s; Mor-2; D17921; B230377B03Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Mdh1; Polyclonal Antibody; Mdh1 Antibody - N-terminal region; anti-MDH1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YSIGNGSVFGKDQPIILVLLDITPMMGVLDGVLMELQDCALPLLQDVIAT
Sequence Length
334
Applicable Applications for anti-MDH1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Mdh1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: Mdh1Sample Type: Mouse Stomach lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: Mdh1Sample Type: Mouse Stomach lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-MDH1 antibody
This is a rabbit polyclonal antibody against Mdh1. It was validated on Western Blot

Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-MDH1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
malate dehydrogenase, cytoplasmic isoform Mdh1
NCBI Official Synonym Full Names
malate dehydrogenase 1, NAD (soluble)
NCBI Official Symbol
Mdh1
NCBI Official Synonym Symbols
MDHA; Mor2; MDH-s; Mor-2; D17921; B230377B03Rik
NCBI Protein Information
malate dehydrogenase, cytoplasmic; malate dehydrogenase, peroxisomal
UniProt Protein Name
Malate dehydrogenase, cytoplasmic
Protein Family
UniProt Gene Name
Mdh1
UniProt Synonym Gene Names
Mor2
UniProt Entry Name
MDHC_MOUSE

NCBI Description

This gene encodes an enzyme that catalyzes the NAD/NADH-dependent, reversible oxidation of malate to oxaloacetate in many metabolic pathways, including the citric acid cycle. Two main isozymes are known to exist in eukaryotic cells: one is found in the mitochondrial matrix and the other in the cytoplasm. This gene encodes the cytosolic isozyme, which plays a key role in the malate-aspartate shuttle that allows malate to pass through the mitochondrial membrane to be transformed into oxaloacetate for further cellular processes. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is localized in the peroxisomes. A pseudogene has been identified on chromosomes 12. [provided by RefSeq, Feb 2016]

Uniprot Description

MDH1: Malate dehydrogenase catalyzes the reversible oxidation of malate to oxaloacetate, utilizing the NAD/NADH cofactor system in the citric acid cycle. The protein encoded by this gene is localized to the cytoplasm and may play pivotal roles in the malate-aspartate shuttle that operates in the metabolic coordination between cytosol and mitochondria. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.[provided by RefSeq, Nov 2010]

Protein type: EC 1.1.1.37; Oxidoreductase; Carbohydrate Metabolism - glyoxylate and dicarboxylate; EC 1.1.1.96; Carbohydrate Metabolism - citrate (TCA) cycle; Carbohydrate Metabolism - pyruvate

Cellular Component: extracellular space; centrosome; mitochondrion; cytoplasm; cytosol; myelin sheath

Molecular Function: malate dehydrogenase activity; L-malate dehydrogenase activity; oxidoreductase activity; NAD binding; catalytic activity; oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor

Biological Process: malate metabolic process; oxaloacetate metabolic process; NADH metabolic process; tricarboxylic acid cycle; NAD metabolic process; carbohydrate metabolic process; carboxylic acid metabolic process

Research Articles on MDH1

Similar Products

Product Notes

The MDH1 mdh1 (Catalog #AAA3208958) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Mdh1 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Mdh1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MDH1 mdh1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YSIGNGSVFG KDQPIILVLL DITPMMGVLD GVLMELQDCA LPLLQDVIAT. It is sometimes possible for the material contained within the vial of "Mdh1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.