Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence analysis of U2OS cells using MBTPS1 antibody. Blue: DAPI for nuclear staining.)

Rabbit anti-Human MBTPS1 Polyclonal Antibody | anti-MBTPS1 antibody

MBTPS1 Polyclonal Antibody

Gene Names
MBTPS1; S1P; PCSK8; SKI-1
Reactivity
Human
Applications
Immunofluorescence
Purity
Affinity Purification
Synonyms
MBTPS1; Polyclonal Antibody; MBTPS1 Polyclonal Antibody; PCSK8; S1P; SKI-1; anti-MBTPS1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
ITQTFKDQGLEVLKQETAVVENVPILGLYQIPAEGGGRIVLYGDSNCLDDSHRQKDCFWLLDALLQYTSYGVTPPSLSHSGNRQRPPSGAGSVTPERMEGNHLHRYSKVLEAHLGDPKPRPLPACPRLSWAKPQPLNETAPSNLWKHQKLLSIDLDKVVLPNFRSNRPQVRPLSPGESGAWDIPGGIMPGRYNQEVGQTIPVFAFLGAMVVLAFFVVQINKAKSRPKRRKPRVKRPQLMQQVHPPKTPSV
Sequence Length
1052
Applicable Applications for anti-MBTPS1 antibody
Immunofluorescence (IF)
Application Notes
IF: 1:50 - 1:200
Immunogen
Recombinant protein of human MBTPS1
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Endoplasmic reticulum membrane, Golgi apparatus membrane, Single-pass type I membrane protein
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.

Immunofluorescence (IF)

(Immunofluorescence analysis of U2OS cells using MBTPS1 antibody. Blue: DAPI for nuclear staining.)

Immunofluorescence (IF) (Immunofluorescence analysis of U2OS cells using MBTPS1 antibody. Blue: DAPI for nuclear staining.)
Related Product Information for anti-MBTPS1 antibody
This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein undergoes an initial autocatalytic processing event in the ER to generate a heterodimer which exits the ER and sorts to the cis/medial-Golgi where a second autocatalytic event takes place and the catalytic activity is acquired. It encodes a type 1 membrane bound protease which is ubiquitously expressed and regulates cholesterol or lipid homeostasis via cleavage of substrates at non-basic residues. Mutations in this gene may be associated with lysosomal dysfunction.
Product Categories/Family for anti-MBTPS1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
117kDa
NCBI Official Full Name
membrane-bound transcription factor site-1 protease preproprotein
NCBI Official Synonym Full Names
membrane bound transcription factor peptidase, site 1
NCBI Official Symbol
MBTPS1
NCBI Official Synonym Symbols
S1P; PCSK8; SKI-1
NCBI Protein Information
membrane-bound transcription factor site-1 protease
UniProt Protein Name
Membrane-bound transcription factor site-1 protease
UniProt Gene Name
MBTPS1
UniProt Synonym Gene Names
KIAA0091; S1P; SKI1; SKI-1

NCBI Description

This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein undergoes an initial autocatalytic processing event in the ER to generate a heterodimer which exits the ER and sorts to the cis/medial-Golgi where a second autocatalytic event takes place and the catalytic activity is acquired. It encodes a type 1 membrane bound protease which is ubiquitously expressed and regulates cholesterol or lipid homeostasis via cleavage of substrates at non-basic residues. Mutations in this gene may be associated with lysosomal dysfunction. [provided by RefSeq, Feb 2014]

Uniprot Description

Serine protease that catalyzes the first step in the proteolytic activation of the sterol regulatory element-binding proteins (SREBPs). Other known substrates are BDNF, GNPTAB and ATF6. Cleaves after hydrophobic or small residues, provided that Arg or Lys is in position P4. Cleaves known substrates after Arg-Ser-Val-Leu (SERBP-2), Arg-His-Leu-Leu (ATF6), Arg-Gly-Leu-Thr (BDNF) and its own propeptide after Arg-Arg-Leu-Leu. Mediates the protein cleavage of GNPTAB into subunit alpha and beta, thereby participating in biogenesis of lysosomes.

Research Articles on MBTPS1

Similar Products

Product Notes

The MBTPS1 mbtps1 (Catalog #AAA9133421) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MBTPS1 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MBTPS1 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF). IF: 1:50 - 1:200. Researchers should empirically determine the suitability of the MBTPS1 mbtps1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ITQTFKDQGL EVLKQETAVV ENVPILGLYQ IPAEGGGRIV LYGDSNCLDD SHRQKDCFWL LDALLQYTSY GVTPPSLSHS GNRQRPPSGA GSVTPERMEG NHLHRYSKVL EAHLGDPKPR PLPACPRLSW AKPQPLNETA PSNLWKHQKL LSIDLDKVVL PNFRSNRPQV RPLSPGESGA WDIPGGIMPG RYNQEVGQTI PVFAFLGAMV VLAFFVVQIN KAKSRPKRRK PRVKRPQLMQ QVHPPKTPSV. It is sometimes possible for the material contained within the vial of "MBTPS1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.