Rabbit anti-Human, Mouse MBTPS1 Polyclonal Antibody | anti-MBTPS1 antibody

MBTPS1 Rabbit pAb

Cat. Num. AAA9142239

• Gene Names: MBTPS1; S1P; PCSK8; SKI-1
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Affinity purification
• Synonyms: MBTPS1; Polyclonal Antibody; MBTPS1 Rabbit pAb; PCSK8; S1P; SKI-1; anti-MBTPS1 antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Affinity purification
• Form/Format: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
• Sequence: ITQTFKDQGLEVLKQETAVVENVPILGLYQIPAEGGGRIVLYGDSNCLDDSHRQKDCFWLLDALLQYTSYGVTPPSLSHSGNRQRPPSGAGSVTPERMEGNHLHRYSKVLEAHLGDPKPRPLPACPRLSWAKPQPLNETAPSNLWKHQKLLSIDLDKVVLPNFRSNRPQVRPLSPGESGAWDIPGGIMPGRYNQEVGQTIPVFAFLGAMVVLAFFVVQINKAKSRPKRRKPRVKRPQLMQQVHPPKTPSV

• Applicable Applications for anti-MBTPS1 antibody: Western Blot (WB)
• Application Notes: WB: 1:500-1:2000
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 803-1052 of human MBTPS1 (NP_003782.1).
• Cellular Location: Endoplasmic reticulum membrane, Golgi apparatus membrane, Single-pass type I membrane protein
• Positive Samples: K-562, Mouse pancreas
• Preparation and Storage: Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using MBTPS1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 1s.)

Related Product Information for anti-MBTPS1 antibody

Background: This gene encodes a member of the subtilisin-like proprotein convertase family, which includes proteases that process protein and peptide precursors trafficking through regulated or constitutive branches of the secretory pathway. The encoded protein undergoes an initial autocatalytic processing event in the ER to generate a heterodimer which exits the ER and sorts to the cis/medial-Golgi where a second autocatalytic event takes place and the catalytic activity is acquired. It encodes a type 1 membrane bound protease which is ubiquitously expressed and regulates cholesterol or lipid homeostasis via cleavage of substrates at non-basic residues. Mutations in this gene may be associated with lysosomal dysfunction.

NCBI and Uniprot Product Information

• NCBI GI #: 4506775
• NCBI GeneID: 8720
• NCBI Accession #: NP_003782.1
• NCBI GenBank Nucleotide #: NM_003791.2
• UniProt Accession #: Q14703; Q24JQ2; Q9UF67
• Molecular Weight: 117,749 Da
• NCBI Official Full Name: membrane-bound transcription factor site-1 protease preproprotein
• NCBI Official Synonym Full Names: membrane-bound transcription factor peptidase, site 1
• NCBI Official Symbol: MBTPS1
• NCBI Official Synonym Symbols: S1P; PCSK8; SKI-1
• NCBI Protein Information: membrane-bound transcription factor site-1 protease; endopeptidase S1P; subtilisin/kexin isozyme-1
• UniProt Protein Name: Membrane-bound transcription factor site-1 protease
• Protein Family: Membrane-bound transcription factor site-1 protease
• UniProt Gene Name: MBTPS1
• UniProt Synonym Gene Names: KIAA0091; S1P; SKI1; SKI-1
• UniProt Entry Name: MBTP1_HUMAN

NCBI Description

The encoded protein has a central role in the regulation of lipid metabolism in cells. It is a sterol-regulated subtilisin-like serine protease that cleaves ER membrane-bound sterol regulatory element-binding proteins (SREBPs), a reaction that initiates the two-step proteolytic process by which transcriptionally active fragments of SREBPs are released from the membrane for translocation to the nucleus. The gene product is an integral membrane ER protein, with the bulk located in the ER lumen. It is synthesized as an inactive preproprotein that is self-activated by an intramolecular cleavage that generates the mature protein. [provided by RefSeq, Jul 2008]

Uniprot Description

MBTPS1: Catalyzes the first step in the proteolytic activation of the sterol regulatory element-binding proteins (SREBPs). Other known substrates are BDNF and ATF6. Cleaves after hydrophobic or small residues, provided that Arg or Lys is in position P4. Cleaves known substrates after Arg-Ser-Val-Leu (SERBP-2), Arg-His- Leu-Leu (ATF6), Arg-Gly-Leu-Thr (BDNF) and its own propeptide after Arg-Arg-Leu-Leu. Belongs to the peptidase S8 family.

Protein type: EC 3.4.21.112; Membrane protein, integral; Endoplasmic reticulum; Protease

Chromosomal Location of Human Ortholog: 16q24

Cellular Component: Golgi membrane; Golgi apparatus; endoplasmic reticulum membrane; Golgi stack; endoplasmic reticulum lumen; integral to membrane

Molecular Function: serine-type endopeptidase activity

Biological Process: cholesterol metabolic process; regulation of transcription factor import into nucleus; unfolded protein response, activation of signaling protein activity; membrane protein intracellular domain proteolysis; cellular protein metabolic process; lysosome organization and biogenesis; unfolded protein response; lipid metabolic process; proteolysis