Western Blot (WB)
(WB Suggested Anti-NSUN6 Antibody Titration: 0.2-1 ug/mlPositive Control: Human muscle)
Rabbit NSUN6 Polyclonal Antibody | anti-NSUN6 antibody
NSUN6 antibody - N-terminal region
Gene Names
NSUN6; NOPD1; ARL5B-AS1; 4933414E04Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NSUN6; Polyclonal Antibody; NSUN6 antibody - N-terminal region; anti-NSUN6 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SIFPKISLRPEVENYLKEGFMNKEIVTALGKQEAERKFETLLKHLSHPPS
Sequence Length
469
Applicable Applications for anti-NSUN6 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 92%; Guinea Pig: 83%; Horse: 85%; Human: 100%; Mouse: 100%; Pig: 92%; Rabbit: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NSUN6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-NSUN6 Antibody Titration: 0.2-1 ug/mlPositive Control: Human muscle)
Western Blot (WB)
(WB Suggested Anti-NSUN6 Antibody Titration: 0.2-1 ug/mlPositive Control: Human muscle)
Related Product Information for anti-NSUN6 antibody
This is a rabbit polyclonal antibody against NSUN6. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: NSUN6 may have S-adenosyl-L-methionine-dependent methyl-transferase activity (Potential). NSUN6 belongs to the methyltransferase superfamily, RsmB/NOP family. It contains 1 PUA domain.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Target Description: NSUN6 may have S-adenosyl-L-methionine-dependent methyl-transferase activity (Potential). NSUN6 belongs to the methyltransferase superfamily, RsmB/NOP family. It contains 1 PUA domain.Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Product Categories/Family for anti-NSUN6 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52kDa
NCBI Official Full Name
putative methyltransferase NSUN6 isoform 1
NCBI Official Synonym Full Names
NOP2/Sun RNA methyltransferase family member 6
NCBI Official Symbol
NSUN6
NCBI Official Synonym Symbols
NOPD1; ARL5B-AS1; 4933414E04Rik
NCBI Protein Information
putative methyltransferase NSUN6
UniProt Protein Name
Putative methyltransferase NSUN6
Protein Family
UniProt Gene Name
NSUN6
UniProt Synonym Gene Names
NOPD1
UniProt Entry Name
NSUN6_HUMAN
Research Articles on NSUN6
Similar Products
Product Notes
The NSUN6 nsun6 (Catalog #AAA3205698) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NSUN6 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's NSUN6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NSUN6 nsun6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SIFPKISLRP EVENYLKEGF MNKEIVTALG KQEAERKFET LLKHLSHPPS. It is sometimes possible for the material contained within the vial of "NSUN6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
