Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MARS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Hela cell lysate)

Rabbit MARS Polyclonal Antibody | anti-MARS antibody

MARS antibody - middle region

Gene Names
MARS; MRS; ILLD; CMT2U; ILFS2; METRS; MTRNS; SPG70
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MARS; Polyclonal Antibody; MARS antibody - middle region; anti-MARS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GHQIGTVSPLFQKLENDQIESLRQRFGGGQAKTSPKPAVVETVTTAKPQQ
Sequence Length
900
Applicable Applications for anti-MARS antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MARS
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MARS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Hela cell lysate)

Western Blot (WB) (WB Suggested Anti-MARS Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Hela cell lysate)
Related Product Information for anti-MARS antibody
This is a rabbit polyclonal antibody against MARS. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. MARS belongs to the class I family of tRNA synthetases.Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. The protein encoded by this gene belongs to the class I family of tRNA synthetases. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-MARS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
101kDa
NCBI Official Full Name
methionine--tRNA ligase, cytoplasmic
NCBI Official Synonym Full Names
methionyl-tRNA synthetase
NCBI Official Symbol
MARS
NCBI Official Synonym Symbols
MRS; ILLD; CMT2U; ILFS2; METRS; MTRNS; SPG70
NCBI Protein Information
methionine--tRNA ligase, cytoplasmic
UniProt Protein Name
Methionine--tRNA ligase, cytoplasmic
Protein Family
UniProt Gene Name
MARS
UniProt Synonym Gene Names
MetRS
UniProt Entry Name
SYMC_HUMAN

NCBI Description

This gene encodes a member of the class I family of aminoacyl-tRNA synthetases. These enzymes play a critical role in protein biosynthesis by charging tRNAs with their cognate amino acids. The encoded protein is a component of the multi-tRNA synthetase complex and catalyzes the ligation of methionine to tRNA molecules. [provided by RefSeq, Jan 2011]

Research Articles on MARS

Similar Products

Product Notes

The MARS mars (Catalog #AAA3201104) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MARS antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MARS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MARS mars for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GHQIGTVSPL FQKLENDQIE SLRQRFGGGQ AKTSPKPAVV ETVTTAKPQQ. It is sometimes possible for the material contained within the vial of "MARS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.