Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MARCH8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Muscle)

Rabbit MARCH8 Polyclonal Antibody | anti-MARCH8 antibody

MARCH8 Antibody - middle region

Gene Names
MARCH8; MIR; CMIR; c-MIR; RNF178; MARCH-VIII
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MARCH8; Polyclonal Antibody; MARCH8 Antibody - middle region; anti-MARCH8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YVQCKVYVQLWKRLKAYNRVIYVQNCPETSKKNIFEKSPLTEPNFENKHG
Sequence Length
291
Applicable Applications for anti-MARCH8 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MARCH8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MARCH8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-MARCH8 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Muscle)
Related Product Information for anti-MARCH8 antibody
This is a rabbit polyclonal antibody against MARCH8. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MARCH8 is an E3 ubiquitin-protein ligase that may regulate immune responses by promoting ubiquitination of MHC-II and CD86, which leads to their subsequent endocytosis and lysosomal degradation. It may also promote ubiquitination and endocytosis of TFRC and FAS. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
Product Categories/Family for anti-MARCH8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase MARCH8 isoform a
NCBI Official Synonym Full Names
membrane associated ring-CH-type finger 8
NCBI Official Symbol
MARCH8
NCBI Official Synonym Symbols
MIR; CMIR; c-MIR; RNF178; MARCH-VIII
NCBI Protein Information
E3 ubiquitin-protein ligase MARCH8
UniProt Protein Name
E3 ubiquitin-protein ligase MARCH8
UniProt Gene Name
MARCH8
UniProt Synonym Gene Names
MIR; RNF178; c-MIR; MARCH-VIII
UniProt Entry Name
MARH8_HUMAN

NCBI Description

MARCH8 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments. MARCH8 induces the internalization of several membrane glycoproteins (Goto et al., 2003 [PubMed 12582153]; Bartee et al., 2004 [PubMed 14722266]).[supplied by OMIM, Apr 2010]

Uniprot Description

MARCH8: E3 ubiquitin-protein ligase that mediates ubiquitination of CD86 and MHC class II proteins, such as HLA-DR alpha and beta, and promotes their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. May also promote ubiquitination and endocytosis of TFRC and FAS.

Protein type: Membrane protein, multi-pass; Ligase; Ubiquitin ligase; Ubiquitin conjugating system; EC 6.3.2.-; EC 6.3.2.19; Membrane protein, integral

Chromosomal Location of Human Ortholog: 10q11.21

Cellular Component: cytoplasmic vesicle membrane; lysosomal membrane; early endosome membrane; lysosome; integral to membrane; endosome

Molecular Function: zinc ion binding; ubiquitin-protein ligase activity; MHC class II protein binding; ligase activity

Biological Process: protein polyubiquitination; antigen processing and presentation of peptide antigen via MHC class II; negative regulation of MHC class II biosynthetic process

Research Articles on MARCH8

Similar Products

Product Notes

The MARCH8 march8 (Catalog #AAA3206851) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MARCH8 Antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MARCH8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MARCH8 march8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YVQCKVYVQL WKRLKAYNRV IYVQNCPETS KKNIFEKSPL TEPNFENKHG. It is sometimes possible for the material contained within the vial of "MARCH8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.