Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MARC2Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit MARC2 Polyclonal Antibody | anti-MARC2 antibody

MARC2 Antibody - C-terminal region

Gene Names
MARC2; MOSC2
Reactivity
Cow, Dog, Human, Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MARC2; Polyclonal Antibody; MARC2 Antibody - C-terminal region; anti-MARC2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ACPRCILTTVDPDTGVIDRKQPLDTLKSYRLCDPSERELYKLSPLFGIYY
Sequence Length
335
Applicable Applications for anti-MARC2 antibody
Western Blot (WB)
Homology
Cow: 91%; Dog: 82%; Human: 100%; Mouse: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MARC2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MARC2Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MARC2Sample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-MARC2 antibody
This is a rabbit polyclonal antibody against MARC2. It was validated on Western Blot

Target Description: As a component of the benzamidoxime prodrug-converting complex, MARC2 is required to reduce N-hydroxylated prodrugs, such as benzamidoxime. It also able to reduce N(omega)-hydroxy-L-arginine (NOHA) and N(omega)-hydroxy-N(delta)-methyl-L-arginine (NHAM) into L-arginine and N(delta)-methyl-L-arginine.
Product Categories/Family for anti-MARC2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
mitochondrial amidoxime reducing component 2 isoform a
NCBI Official Synonym Full Names
mitochondrial amidoxime reducing component 2
NCBI Official Symbol
MARC2
NCBI Official Synonym Symbols
MOSC2
NCBI Protein Information
mitochondrial amidoxime reducing component 2
UniProt Protein Name
MOSC domain-containing protein 2, mitochondrial
UniProt Gene Name
MOSC2
UniProt Entry Name
MOSC2_HUMAN

NCBI Description

The protein encoded by this gene is an enzyme found in the outer mitochondrial membrane that reduces N-hydroxylated substrates. The encoded protein uses molybdenum as a cofactor and cytochrome b5 type B and NADH cytochrome b5 reductase as accessory proteins. One type of substrate used is N-hydroxylated nucleotide base analogues, which can be toxic to a cell. Other substrates include N(omega)-hydroxy-L-arginine (NOHA) and amidoxime prodrugs, which are activated by the encoded enzyme. Multiple transcript variants encoding the different isoforms have been found for this gene. [provided by RefSeq, Sep 2016]

Uniprot Description

MOSC2: As a component of the benzamidoxime prodrug-converting complex required to reduce N-hydroxylated prodrugs, such as benzamidoxime. Also able to reduce N(omega)-hydroxy-L-arginine (NOHA) and N(omega)-hydroxy-N(delta)-methyl-L-arginine (NHAM) into L-arginine and N(delta)-methyl-L-arginine, respectively. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 1.-.-.-; Oxidoreductase; Mitochondrial

Chromosomal Location of Human Ortholog: 1q41

Cellular Component: mitochondrial outer membrane; mitochondrion; mitochondrial inner membrane; peroxisome

Molecular Function: molybdopterin cofactor binding; nitrate reductase activity; molybdenum ion binding; pyridoxal phosphate binding

Biological Process: detoxification of nitrogen compound; nitrate metabolic process

Research Articles on MARC2

Similar Products

Product Notes

The MARC2 mosc2 (Catalog #AAA3217907) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MARC2 Antibody - C-terminal region reacts with Cow, Dog, Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's MARC2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MARC2 mosc2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ACPRCILTTV DPDTGVIDRK QPLDTLKSYR LCDPSERELY KLSPLFGIYY. It is sometimes possible for the material contained within the vial of "MARC2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.