Western Blot (WB)
(Anti- Arc Picoband antibody, MBS177684, Western blottingAll lanes: Anti Arc (MBS177684) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Rat Testis Tissue Lysate at 50ugLane 3: Mouse Brain Tissue Lysate at 50ugLane 4: PANC Whole Cell Lysate at 40ugLane 5: HELA Whole Cell Lysate at 40ugLane 6: MCF-7 Whole Cell Lysate at 40ugPredicted bind size: 45KDObserved bind size: 45KD )
Arc Polyclonal Antibody | anti-ARC antibody
Anti-Arc Antibody
Gene Names
ARC; Arg3.1
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
Arc; Polyclonal Antibody; Anti-Arc Antibody; Activity-regulated cytoskeleton-associated protein; activity regulated cytoskeleton associated protein; activity regulated gene 3.1 protein homolog; Activity-regulated gene 3.1 protein homolog; ARC/ARG3.1; ARC_HUMAN; Arg3.1; activity-regulated cytoskeleton-associated protein; anti-ARC antibody
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
396
Applicable Applications for anti-ARC antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Arc (332-366aa KLKRFLRHPLPKTLEQLIQRGMEVQDDLEQAAEPA), different from the related mouse sequence by two amino acids, and from the related rat sequence by three amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Western Blot (WB)
(Anti- Arc Picoband antibody, MBS177684, Western blottingAll lanes: Anti Arc (MBS177684) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Rat Testis Tissue Lysate at 50ugLane 3: Mouse Brain Tissue Lysate at 50ugLane 4: PANC Whole Cell Lysate at 40ugLane 5: HELA Whole Cell Lysate at 40ugLane 6: MCF-7 Whole Cell Lysate at 40ugPredicted bind size: 45KDObserved bind size: 45KD )
Western Blot (WB)
(Anti- Arc Picoband antibody, MBS177684, Western blottingAll lanes: Anti Arc (MBS177684) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Rat Testis Tissue Lysate at 50ugLane 3: Mouse Brain Tissue Lysate at 50ugLane 4: PANC Whole Cell Lysate at 40ugLane 5: HELA Whole Cell Lysate at 40ugLane 6: MCF-7 Whole Cell Lysate at 40ugPredicted bind size: 45KDObserved bind size: 45KD )
Related Product Information for anti-ARC antibody
Description: Rabbit IgG polyclonal antibody for Activity-regulated cytoskeleton-associated protein(ARC) detection. Tested with WB in Human;Mouse;Rat.
Background: ARC, officially called activity-regulated cytoskeleton-associated protein, is a plasticity protein first characterized in 1995. It is a member of the immediate-early gene (IEG) family. The ARC gene is mapped to chromosome 8q24. It has got 460 amino acid protein which shares significant similarity with rat Arc. The Arc is highly expressed in heart, brain, lung, skeletal muscle, pancreas, prostate and testis and has got weak expression in small intestine, colon, and peripheral blood leukocytes. Arc is widely considered to be an important protein in neurobiology and also a significant tool for systems neuroscience.
Background: ARC, officially called activity-regulated cytoskeleton-associated protein, is a plasticity protein first characterized in 1995. It is a member of the immediate-early gene (IEG) family. The ARC gene is mapped to chromosome 8q24. It has got 460 amino acid protein which shares significant similarity with rat Arc. The Arc is highly expressed in heart, brain, lung, skeletal muscle, pancreas, prostate and testis and has got weak expression in small intestine, colon, and peripheral blood leukocytes. Arc is widely considered to be an important protein in neurobiology and also a significant tool for systems neuroscience.
References
1. Guzowski JF, McNaughton BL, Barnes CA, Worley PF (1999). "Environment-specific expression of the immediate-early gene Arc in hippocampal neuronal ensembles." Nature Neuroscience. 2:1120-1124. 2. Lyford GL, Yamagata K, Kaufmann WE, Barnes CA, Sanders LK, Copeland NG, Worley PF (1995). "Arc, a growth factor and activity-regulated gene, encodes a novel cytoskeletal-associated protein that is enriched in neuronal dendrites." Neuron. 14:433-445. 3. Link W, Konietzko U, Kauselmann G, Krug M, Schwanke B, Frey U, Kuhl D (1995). "Somatodendritic expression of an immediate early gene is regulated by synaptic activity." Proc Nat Acad Sci. 6;92(12):57 34-38. 4. Vazdarjanova A, McNaughton BL, Barnes CA, Worley PF, Guzowski JF (2002). "Experience-dependent coincident expression of the effector immediate-early genes Arc and Homer 1a in hippocampal and neocortical neuronal networks." J Neurosci. 1:10067-10071.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
45,316 Da
NCBI Official Full Name
activity-regulated cytoskeleton-associated protein
NCBI Official Synonym Full Names
activity-regulated cytoskeleton-associated protein
NCBI Official Symbol
ARC
NCBI Official Synonym Symbols
Arg3.1
NCBI Protein Information
activity-regulated cytoskeleton-associated protein
UniProt Protein Name
Activity-regulated cytoskeleton-associated protein
Protein Family
UniProt Gene Name
ARC
UniProt Synonym Gene Names
Arg3.1
UniProt Entry Name
ARC_HUMAN
Uniprot Description
ARG3.1: Required for consolidation of synaptic plasticity as well as formation of long-term memory. Regulates endocytosis of AMPA receptors in response to synaptic activity. Required for homeostatic synaptic scaling of AMPA receptors. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the stress fiber dynamics and cell migration. Belongs to the ARC/ARG3.1 family.
Protein type: Cytoskeletal; Motility/polarity/chemotaxis
Chromosomal Location of Human Ortholog: 8q24.3
Cellular Component: acrosome; actin cytoskeleton; cell junction; cytoplasm; dendritic spine; endosome; plasma membrane; postsynaptic density; postsynaptic membrane
Biological Process: anterior/posterior pattern formation; cell migration; cytoskeleton organization and biogenesis; endocytosis; endoderm development; learning; regulation of cell morphogenesis; regulation of neuronal synaptic plasticity
Research Articles on ARC
Similar Products
Product Notes
The ARC arc (Catalog #AAA177684) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-Arc Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Arc can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the ARC arc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Arc, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
