Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MAOASample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human MAOA Polyclonal Antibody | anti-MAOA antibody

MAOA Antibody - middle region

Gene Names
MAOA; BRNRS; MAO-A
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MAOA; Polyclonal Antibody; MAOA Antibody - middle region; anti-MAOA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIAYLDYNNLWRTIDNMGKE
Sequence Length
167
Applicable Applications for anti-MAOA antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MAOA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MAOASample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MAOASample Tissue: Human Fetal LiverAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-MAOA antibody
This gene is one of two neighboring gene family members that encode mitochondrial enzymes which catalyze the oxidative deamination of amines, such as dopamine, norepinephrine, and serotonin. Mutation of this gene results in Brunner syndrome. This gene has also been associated with a variety of other psychiatric disorders, including antisocial behavior. Alternatively spliced transcript variants encoding multiple isoforms have been observed.
Product Categories/Family for anti-MAOA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60 kDa
NCBI Official Full Name
amine oxidase
NCBI Official Synonym Full Names
monoamine oxidase A
NCBI Official Symbol
MAOA
NCBI Official Synonym Symbols
BRNRS; MAO-A
NCBI Protein Information
amine oxidase [flavin-containing] A
UniProt Protein Name
Amine oxidase [flavin-containing] A
Protein Family
UniProt Gene Name
MAOA
UniProt Synonym Gene Names
MAO-A
UniProt Entry Name
AOFA_HUMAN

NCBI Description

This gene is one of two neighboring gene family members that encode mitochondrial enzymes which catalyze the oxidative deamination of amines, such as dopamine, norepinephrine, and serotonin. Mutation of this gene results in Brunner syndrome. This gene has also been associated with a variety of other psychiatric disorders, including antisocial behavior. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Jul 2012]

Uniprot Description

MAOA: Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine. Defects in MAOA are the cause of Brunner syndrome (BRUNS). Brunner syndrome is a form of X-linked non- dysmorphic mild mental retardation. Male patients are affected by a syndrome of borderline mental retardation and exhibit abnormal behavior, including disturbed regulation of impulsive aggression. Obligate female carriers have normal intelligence and behavior. Belongs to the flavin monoamine oxidase family.

Protein type: EC 1.4.3.4; Membrane protein, integral; Amino Acid Metabolism - tryptophan; Xenobiotic Metabolism - drug metabolism - cytochrome P450; Amino Acid Metabolism - histidine; Amino Acid Metabolism - arginine and proline; Amino Acid Metabolism - phenylalanine; Amino Acid Metabolism - glycine, serine and threonine; Oxidoreductase; Amino Acid Metabolism - tyrosine

Chromosomal Location of Human Ortholog: Xp11.3

Cellular Component: mitochondrial outer membrane; mitochondrion; integral to membrane

Molecular Function: amine oxidase activity

Biological Process: synaptic transmission; biogenic amine metabolic process; neurotransmitter catabolic process; dopamine catabolic process; xenobiotic metabolic process; neurotransmitter secretion; neurotransmitter biosynthetic process

Disease: Brunner Syndrome

Research Articles on MAOA

Similar Products

Product Notes

The MAOA maoa (Catalog #AAA3220335) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MAOA Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MAOA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MAOA maoa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TYKVNVSERL VQYVKGKTYP FRGAFPPVWN PIAYLDYNNL WRTIDNMGKE. It is sometimes possible for the material contained within the vial of "MAOA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.