Western Blot (WB)
(Western Blot analysis of LYZL2 expression in transfected 293T cell line by LYZL2 polyclonal antibody. Lane 1: LYZL2 transfected lysate (21.34kD). Lane 2: Non-transfected lysate.)
Mouse anti-Human LYZL2 Polyclonal Antibody | anti-LYZL2 antibody
LYZL2 (Lysozyme-like Protein 2, Lysozyme-2)
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
LYZL2; Polyclonal Antibody; LYZL2 (Lysozyme-like Protein 2; Lysozyme-2); Anti -LYZL2 (Lysozyme-like Protein 2; anti-LYZL2 antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human LYZL2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MQDAPLSCLSPTKWSSVSSADSTEKSASAAGTRNLPFQFCLRQALRMKAAGILTLIGCLVTGAESKIYTRCKLAKIFSRAGLDNYWGFSLGNWICMAYYESGYNTTAQTVLDDGSIDYGIFQINSFAWCRRGKLKENNHCHVACSALVTDDLTDAIICAKKIVKETQGMNYWQGWKKHCEGRDLSDWKKDCEVS
Applicable Applications for anti-LYZL2 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human LYZL2, aa1-194 (NP_898881.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of LYZL2 expression in transfected 293T cell line by LYZL2 polyclonal antibody. Lane 1: LYZL2 transfected lysate (21.34kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of LYZL2 expression in transfected 293T cell line by LYZL2 polyclonal antibody. Lane 1: LYZL2 transfected lysate (21.34kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-LYZL2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
16,656 Da
NCBI Official Full Name
lysozyme-like protein 2
NCBI Official Synonym Full Names
lysozyme-like 2
NCBI Official Symbol
LYZL2
NCBI Protein Information
lysozyme-like protein 2; lysozyme 2; lysozyme-2
UniProt Protein Name
Lysozyme-like protein 2
Protein Family
UniProt Gene Name
LYZL2
UniProt Synonym Gene Names
Lysozyme-2
UniProt Entry Name
LYZL2_HUMAN
NCBI Description
Lysozymes (see LYZ; MIM 153450), especially C-type lysozymes, are well-recognized bacteriolytic factors widely distributed in the animal kingdom and play a mainly protective role in host defense. LYZL2 is a member of a family of lysozyme-like genes (Zhang et al., 2005 [PubMed 16014814]).[supplied by OMIM, Apr 2009]
Uniprot Description
Catalytic activity: Hydrolysis of (1->4)-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues in a peptidoglycan and between N-acetyl-D-glucosamine residues in chitodextrins.
Subunit structure: Monomer
Probable.
Subcellular location: Secreted
Probable.
Tissue specificity: Expressed in testis, epididymis and placenta. Ref.1
Sequence similarities: Belongs to the glycosyl hydrolase 22 family.
Research Articles on LYZL2
Similar Products
Product Notes
The LYZL2 lyzl2 (Catalog #AAA648747) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The LYZL2 (Lysozyme-like Protein 2, Lysozyme-2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LYZL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the LYZL2 lyzl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MQDAPLSCLS PTKWSSVSSA DSTEKSASAA GTRNLPFQFC LRQALRMKAA GILTLIGCLV TGAESKIYTR CKLAKIFSRA GLDNYWGFSL GNWICMAYYE SGYNTTAQTV LDDGSIDYGI FQINSFAWCR RGKLKENNHC HVACSALVTD DLTDAIICAK KIVKETQGMN YWQGWKKHCE GRDLSDWKKD CEVS. It is sometimes possible for the material contained within the vial of "LYZL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
