Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Figure 1. Western blot analysis of GRK2 using anti-GRK2 antibody (MBS1750653). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat spleen tissue lysates,Lane 2: rat stomach tissue lysates,Lane 3: mouse lung tissue lysates,Lane 4: mouse liver tissue lysates,Lane 5: mouse pancreas tissue lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-GRK2 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for GRK2 at approximately 79KD. The expected band size for GRK2 is at 79KD. )

Rabbit GRK2 Polyclonal Antibody | anti-GRK2 antibody

Anti-GRK2 Picoband antibody

Gene Names
GRK2; BARK1; ADRBK1; BETA-ARK1
Reactivity
Mouse, Rat
Predicted Reactivity: Human
No cross reactivity with other proteins.
Applications
Western Blot
Synonyms
GRK2; Polyclonal Antibody; Anti-GRK2 Picoband antibody; Beta-adrenergic receptor kinase 1; Beta-ARK-1; G-protein coupled receptor kinase 2; anti-GRK2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse, Rat
Predicted Reactivity: Human
No cross reactivity with other proteins.
Clonality
Polyclonal
Form/Format
Lyophilized
Sequence Length
689
Applicable Applications for anti-GRK2 antibody
Western Blot (WB)
Application Notes
WB: 0.1-0.5mug/ml
Immunogen
A synthetic peptide corresponding to a sequence of human GRK2 (DSDPELVQWKKELRDAYREAQQLVQRVPKMKNK).
Subcellular Localization
Cytoplasm.
Tissue Specificity
Expressed in peripheral blood leukocytes.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Figure 1. Western blot analysis of GRK2 using anti-GRK2 antibody (MBS1750653). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat spleen tissue lysates,Lane 2: rat stomach tissue lysates,Lane 3: mouse lung tissue lysates,Lane 4: mouse liver tissue lysates,Lane 5: mouse pancreas tissue lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-GRK2 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for GRK2 at approximately 79KD. The expected band size for GRK2 is at 79KD. )

Western Blot (WB) (Figure 1. Western blot analysis of GRK2 using anti-GRK2 antibody (MBS1750653). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat spleen tissue lysates,Lane 2: rat stomach tissue lysates,Lane 3: mouse lung tissue lysates,Lane 4: mouse liver tissue lysates,Lane 5: mouse pancreas tissue lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-GRK2 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for GRK2 at approximately 79KD. The expected band size for GRK2 is at 79KD. )
Related Product Information for anti-GRK2 antibody
Specifically phosphorylates the agonist-occupied form of the beta-adrenergic and closely related receptors, probably inducing a desensitization of them. Key regulator of LPAR1 signaling. Competes with RALA for binding to LPAR1 thus affecting the signaling properties of the receptor. Desensitizes LPAR1 and LPAR2 in a phosphorylation-independent manner.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
156
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
79,574 Da
NCBI Official Full Name
beta-adrenergic receptor kinase 1
NCBI Official Synonym Full Names
G protein-coupled receptor kinase 2
NCBI Official Symbol
GRK2
NCBI Official Synonym Symbols
BARK1; ADRBK1; BETA-ARK1
NCBI Protein Information
beta-adrenergic receptor kinase 1
UniProt Protein Name
Beta-adrenergic receptor kinase 1
UniProt Gene Name
GRK2
UniProt Synonym Gene Names
Beta-ARK-1

NCBI Description

This gene encodes a member of the G protein-coupled receptor kinase family of proteins. The encoded protein phosphorylates the beta-adrenergic receptor as well as a wide range of other substrates including non-GPCR cell surface receptors, and cytoskeletal, mitochondrial, and transcription factor proteins. Data from rodent models supports a role for this gene in embryonic development, heart function and metabolism. Elevated expression of this gene has been observed in human patients with heart failure and Alzheimer's disease. [provided by RefSeq, Sep 2017]

Uniprot Description

Specifically phosphorylates the agonist-occupied form of the beta-adrenergic and closely related receptors, probably inducing a desensitization of them. Key regulator of LPAR1 signaling. Competes with RALA for binding to LPAR1 thus affecting the signaling properties of the receptor. Desensitizes LPAR1 and LPAR2 in a phosphorylation-independent manner.

Research Articles on GRK2

Similar Products

Product Notes

The GRK2 grk2 (Catalog #AAA1750653) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-GRK2 Picoband antibody reacts with Mouse, Rat Predicted Reactivity: Human No cross reactivity with other proteins. and may cross-react with other species as described in the data sheet. AAA Biotech's GRK2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 0.1-0.5mug/ml. Researchers should empirically determine the suitability of the GRK2 grk2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GRK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.