Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit anti-Human LY6G6D Polyclonal Antibody | anti-LY6G6D antibody

LY6G6D Antibody - N-terminal region

Gene Names
LY6G6D; G6D; NG25; LY6-D; MEGT1; C6orf23
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LY6G6D; Polyclonal Antibody; LY6G6D Antibody - N-terminal region; anti-LY6G6D antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVT
Sequence Length
133
Applicable Applications for anti-LY6G6D antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human LY6G6D
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: LY6G6DSample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)

Related Product Information for anti-LY6G6D antibody
This is a rabbit polyclonal antibody against LY6G6D. It was validated on Western Blot

Target Description: LY6G6D belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. Most LY6 proteins are attached to the cell surface by a glycosylphosphatidylinositol (GPI) anchor that is directly involved in signal transduction.
Product Categories/Family for anti-LY6G6D antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15kDa
NCBI Official Full Name
lymphocyte antigen 6 complex locus protein G6d
NCBI Official Synonym Full Names
lymphocyte antigen 6 family member G6D
NCBI Official Symbol
LY6G6D
NCBI Official Synonym Symbols
G6D; NG25; LY6-D; MEGT1; C6orf23
NCBI Protein Information
lymphocyte antigen 6 complex locus protein G6d
UniProt Protein Name
Lymphocyte antigen 6 complex locus protein G6d
UniProt Gene Name
LY6G6D
UniProt Synonym Gene Names
C6orf23; G6D; MEGT1; NG25; Protein Ly6-D
UniProt Entry Name
LY66D_HUMAN

NCBI Description

LY6G6D belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. Most LY6 proteins are attached to the cell surface by a glycosylphosphatidylinositol (GPI) anchor that is directly involved in signal transduction (Mallya et al., 2002 [PubMed 12079290]).[supplied by OMIM, Apr 2009]

Uniprot Description

LY6G6D: Homodimer.

Protein type: Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: plasma membrane; filopodium

Research Articles on LY6G6D

Similar Products

Product Notes

The LY6G6D ly6g6d (Catalog #AAA3217267) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LY6G6D Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LY6G6D can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LY6G6D ly6g6d for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LGAALGNRMR CYNCGGSPSS SCKEAVTTCG EGRPQPGLEQ IKLPGNPPVT. It is sometimes possible for the material contained within the vial of "LY6G6D, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual