Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: LTKSample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human LTK Polyclonal Antibody | anti-LTK antibody

LTK Antibody - middle region

Gene Names
LTK; TYK1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
LTK; Polyclonal Antibody; LTK Antibody - middle region; anti-LTK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VGLSLRATPRLILLELMSGGDMKSFLRHSRPHLGQPSPLVMRDLLQLAQD
Sequence Length
734
Applicable Applications for anti-LTK antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle terminal region of human LTK
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: LTKSample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: LTKSample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-LTK antibody
The protein encoded by this gene is a member of the ros/insulin receptor family of tyrosine kinases. Tyrosine-specific phosphorylation of proteins is a key to the control of diverse pathways leading to cell growth and differentiation. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-LTK antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
80 kDa
NCBI Official Full Name
leukocyte tyrosine kinase receptor isoform 3
NCBI Official Synonym Full Names
leukocyte receptor tyrosine kinase
NCBI Official Symbol
LTK
NCBI Official Synonym Symbols
TYK1
NCBI Protein Information
leukocyte tyrosine kinase receptor
UniProt Protein Name
Leukocyte tyrosine kinase receptor
UniProt Gene Name
LTK
UniProt Synonym Gene Names
TYK1
UniProt Entry Name
LTK_HUMAN

NCBI Description

The protein encoded by this gene is a member of the ros/insulin receptor family of tyrosine kinases. Tyrosine-specific phosphorylation of proteins is a key to the control of diverse pathways leading to cell growth and differentiation. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008]

Uniprot Description

LTK: Orphan receptor with a tyrosine-protein kinase activity. The exact function of this protein is not known. Studies with chimeric proteins (replacing its extracellular region with that of several known growth factor receptors, such as EGFR and CSFIR) demonstrate its ability to promote growth and specifically neurite outgrowth, and cell survival. Signaling appears to involve the PI3 kinase pathway. Involved in regulation of the secretory pathway involving endoplasmic reticulum (ER) export sites (ERESs) and ER to Golgi transport. Homodimer when bound to ligand (Probable). Part a complex including LTK, TNK2 and GRB2, in which GRB2 promotes LTK recruitment by TNK2. Expressed in non-hematopoietic cell lines and T- and B-cell lines. Belongs to the protein kinase superfamily. Tyr protein kinase family. Insulin receptor subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Protein kinase, tyrosine (receptor); Protein kinase, TK; Kinase, protein; EC 2.7.10.1; TK group; Alk family

Chromosomal Location of Human Ortholog: 15q15.1-q21.1

Cellular Component: membrane; integral to plasma membrane; plasma membrane

Molecular Function: protein-tyrosine kinase activity; transmembrane receptor protein tyrosine kinase activity; ATP binding; protein kinase activity

Biological Process: cell proliferation; phosphoinositide 3-kinase cascade; peptidyl-tyrosine phosphorylation; signal transduction; protein amino acid phosphorylation; transmembrane receptor protein tyrosine kinase signaling pathway; negative regulation of apoptosis

Research Articles on LTK

Similar Products

Product Notes

The LTK ltk (Catalog #AAA3222430) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LTK Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LTK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LTK ltk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VGLSLRATPR LILLELMSGG DMKSFLRHSR PHLGQPSPLV MRDLLQLAQD. It is sometimes possible for the material contained within the vial of "LTK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.