Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (VGLL2 polyclonal antibody. Western Blot analysis of VGLL2 expression in human kidney.)

Mouse anti-Human VGLL2 Polyclonal Antibody | anti-Vgll2 antibody

VGLL2 (Transcription Cofactor Vestigial-like Protein 2, VGL2, Vgl-2, Protein VITO1, VITO1)

Gene Names
Vgll2; Vito1; VITO-1; C130057C21Rik
Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
VGLL2; Polyclonal Antibody; VGLL2 (Transcription Cofactor Vestigial-like Protein 2; VGL2; Vgl-2; Protein VITO1; VITO1); Anti -VGLL2 (Transcription Cofactor Vestigial-like Protein 2; anti-Vgll2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human VGLL2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSCLDVMYQVYGPPQPYFAAAYTPYHQKLAYYSKMQEAQECNASPSSSGSGSSSFSSQTPASIKEEEGSPEKERPPEAEYINSRCVLFTYFQGDISSVVDEHFSRALSQPSSYSPSCTSSKAPRSSGPWRDCSFPMSQRSFPASFWNSAYQAPVPPPLGSPLATAHSELPFAAADPYSPAALHGHLHQGATEPWHHAHPHHAHPHHPYALGGALGAQAAPYPRPAAVHEVYAPHFDPRYGPLLMPAASGRPARLATAPAPAPGSPPCELSGKGEPAGAAWAGPGGPFASPSGDVAQGLGLSVDSARRYSLCGASLLS
Applicable Applications for anti-Vgll2 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length human VGLL2, aa1-317 (NP_872586.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(VGLL2 polyclonal antibody. Western Blot analysis of VGLL2 expression in human kidney.)

Western Blot (WB) (VGLL2 polyclonal antibody. Western Blot analysis of VGLL2 expression in human kidney.)

Western Blot (WB)

(Western Blot analysis of VGLL2 expression in transfected 293T cell line by VGLL2 polyclonal antibody. Lane 1: VGLL2 transfected lysate (34.87kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of VGLL2 expression in transfected 293T cell line by VGLL2 polyclonal antibody. Lane 1: VGLL2 transfected lysate (34.87kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to VGLL2 on HepG2 cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of purified antibody to VGLL2 on HepG2 cell. [antibody concentration 10ug/ml])
Product Categories/Family for anti-Vgll2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
34,064 Da
NCBI Official Full Name
Vgll2 protein
NCBI Official Synonym Full Names
vestigial like 2 homolog (Drosophila)
NCBI Official Symbol
Vgll2
NCBI Official Synonym Symbols
Vito1; VITO-1; C130057C21Rik
NCBI Protein Information
transcription cofactor vestigial-like protein 2; vgl-2
UniProt Protein Name
Transcription cofactor vestigial-like protein 2
UniProt Gene Name
Vgll2
UniProt Synonym Gene Names
Vgl2; Vito1; Vgl-2
UniProt Entry Name
VGLL2_MOUSE

NCBI Description

This gene is a member of the Vestigial-like (Vgl) gene family and is upregulated during muscle differentiation. The product of this gene interacts with and modifies the DNA-binding properties of the transcription factor, TEF-1, and is important for muscle tissue development. Reduced expression of this gene leads to a reduction in the terminal differentiation of muscle cells. Alternate splicing results in multiple protein isoforms. [provided by RefSeq, Jul 2014]

Uniprot Description

Function: May act as a specific coactivator for the mammalian TEFs. May play a role in the development of skeletal muscles. Ref.1

Subunit structure: Interacts with TEFs. Binds to TEAD1/TEF1. Ref.1

Subcellular location: Nucleus Ref.1.

Tissue specificity: Skeletal muscle specific. Ref.2

Developmental stage: Expressed in the somitic myotome from E8.75 mouse embryos onwards and later on in skeletal muscle but not in the heart. Additional expression domains during development are detected in the pharyngeal pouches and clefts starting at E8.0 as well as in the cranial pharynx and in Rathkes pouch. Ref.2

Sequence similarities: Belongs to the vestigial family.

Research Articles on Vgll2

Similar Products

Product Notes

The Vgll2 vgll2 (Catalog #AAA647591) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The VGLL2 (Transcription Cofactor Vestigial-like Protein 2, VGL2, Vgl-2, Protein VITO1, VITO1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's VGLL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the Vgll2 vgll2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSCLDVMYQV YGPPQPYFAA AYTPYHQKLA YYSKMQEAQE CNASPSSSGS GSSSFSSQTP ASIKEEEGSP EKERPPEAEY INSRCVLFTY FQGDISSVVD EHFSRALSQP SSYSPSCTSS KAPRSSGPWR DCSFPMSQRS FPASFWNSAY QAPVPPPLGS PLATAHSELP FAAADPYSPA ALHGHLHQGA TEPWHHAHPH HAHPHHPYAL GGALGAQAAP YPRPAAVHEV YAPHFDPRYG PLLMPAASGR PARLATAPAP APGSPPCELS GKGEPAGAAW AGPGGPFASP SGDVAQGLGL SVDSARRYSL CGASLLS. It is sometimes possible for the material contained within the vial of "VGLL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.