Western Blot (WB)
(Western blot analysis of LRIG3 expression in rat testis extract (lane 1) and HEPG2 whole cell lysates (lane 2). LRIG3 at 123KD was detected using rabbit anti- LRIG3 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Rabbit anti-Human, Rat LRIG3 Polyclonal Antibody | anti-LRIG3 antibody
Anti-LRIG3 Antibody
Gene Names
LRIG3; LIG3
Reactivity
Human, Rat
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
LRIG3; Polyclonal Antibody; Anti-LRIG3 Antibody; LIG-3; LIG3; LRIG1-3; Lrig3; Q6UXM1; Leucine-rich repeats and immunoglobulin-like domains protein 3; leucine rich repeats and immunoglobulin like domains 3; anti-LRIG3 antibody
Host
Rabbit
Reactivity
Human, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
1059
Applicable Applications for anti-LRIG3 antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5ug/ml
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human LRIG3 (428-465aa NAFSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAENNFQ), different from the related mouse sequence by one amino acid.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
Western Blot (WB)
(Western blot analysis of LRIG3 expression in rat testis extract (lane 1) and HEPG2 whole cell lysates (lane 2). LRIG3 at 123KD was detected using rabbit anti- LRIG3 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Western Blot (WB)
(Western blot analysis of LRIG3 expression in rat testis extract (lane 1) and HEPG2 whole cell lysates (lane 2). LRIG3 at 123KD was detected using rabbit anti- LRIG3 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-LRIG3 antibody
Rabbit IgG polyclonal antibody for Leucine-rich repeats and immunoglobulin-like domains protein 3(LRIG3) detection.
Background: LRIG3 (leucine-rich repeats and Ig-like domains-3) is a 140 kDa type I transmembrane glycoprotein member of the mammalian LRIG glycoprotein family. It shares 46.8% and 54.0% amino acid identity with LRIG1 and LRIG2, respectively, with highest conservation in the extracellular, transmembrane, and membrane-proximal sequences. This gene is mapped to chromosome 12q13.2. LRIG3 may play a role in craniofacial and inner ear morphogenesis during embryonic development. It also may act within the otic vesicle epithelium to control formation of the lateral semicircular canal in the inner ear, possibly by restricting the expression of NTN1.
Background: LRIG3 (leucine-rich repeats and Ig-like domains-3) is a 140 kDa type I transmembrane glycoprotein member of the mammalian LRIG glycoprotein family. It shares 46.8% and 54.0% amino acid identity with LRIG1 and LRIG2, respectively, with highest conservation in the extracellular, transmembrane, and membrane-proximal sequences. This gene is mapped to chromosome 12q13.2. LRIG3 may play a role in craniofacial and inner ear morphogenesis during embryonic development. It also may act within the otic vesicle epithelium to control formation of the lateral semicircular canal in the inner ear, possibly by restricting the expression of NTN1.
References
1. Guo, D., Holmlund, C., Henriksson, R., Hedman, H. The LRIG gene family has three vertebrate paralogs widely expressed in human and mouse tissues and a homolog in Ascidiacea. Genomics 84: 157-165, 2004.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
117,438 Da
NCBI Official Full Name
leucine-rich repeats and immunoglobulin-like domains protein 3 isoform 1
NCBI Official Synonym Full Names
leucine rich repeats and immunoglobulin like domains 3
NCBI Official Symbol
LRIG3
NCBI Official Synonym Symbols
LIG3
NCBI Protein Information
leucine-rich repeats and immunoglobulin-like domains protein 3
UniProt Protein Name
Leucine-rich repeats and immunoglobulin-like domains protein 3
Protein Family
UniProt Gene Name
LRIG3
UniProt Synonym Gene Names
LIG3; LIG-3
Uniprot Description
LRIG3: 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral
Chromosomal Location of Human Ortholog: 12q14.1
Cellular Component: extracellular space
Research Articles on LRIG3
Similar Products
Product Notes
The LRIG3 lrig3 (Catalog #AAA178833) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-LRIG3 Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LRIG3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the LRIG3 lrig3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LRIG3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
