Mouse anti-Human, Mouse LPXN Polyclonal Antibody | anti-LPXN antibody

LPXN (LDLP, Leupaxin)

Cat. Num. AAA6010139

• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: LPXN; Polyclonal Antibody; LPXN (LDLP; Leupaxin); Anti -LPXN (LDLP; anti-LPXN antibody

• Host: Mouse
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human LPXN.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MEELDALLEELERSTLQDSDEYSNPAPLPLDQHSRKETNLDETSEILSIQDNTSPLPAQLVYTTNIQELNVYSEAQEPKESPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPDKQDHKASLDSMLGGLEQELQDLGIATVPKGHCASCQKPIAGKVIHALGQSWHPEHFVCTHCKEEIGSSPFFERSGLAYCPNDYHQLFSPRCAYCAAPILDKVLTAMNQTWHPEHFFCSHCGEVFGAEGFHEKDKKPYCRKDFLAMFSPKCGGCNRPVLENYLSAMDTVWHPECFVCGDCFTSFSTGSFFELDGRPFCELHYHHRRGTLCHGCGQPITGRCISAMGYKFHPEHFVCAFCLTQLSKGIFREQNDKTYCQPCFNKLFPL

• Applicable Applications for anti-LPXN antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human LPXN, aa1-386 (NP_004802.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of LPXN expression in transfected 293T cell line by LPXN polyclonal antibody. Lane 1: LPXN transfected lysate (42.46kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-LPXN antibody

The product encoded by this gene is preferentially expressed in hematopoietic cells and belongs to the paxillin protein family. Similar to other members of this focal-adhesion-associated adaptor-protein family, it has four leucine-rich LD-motifs in the N-terminus and four LIM domains in the C-terminus. It may function in cell type-specific signaling by associating with PYK2, a member of focal adhesion kinase family. As a substrate for a tyrosine kinase in lymphoid cells, this protein may also function in, and be regulated by, tyrosine kinase activity. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

Product Categories/Family for anti-LPXN antibody

Antibodies; Abs to Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 49168546
• UniProt Accession #: Q6FI07; Q53FW6; B2R8B4; B4DV71
• Molecular Weight: 43,332 Da
• NCBI Official Full Name: LPXN
• UniProt Protein Name: Leupaxin
• Protein Family: Leupaxin
• UniProt Gene Name: LPXN
• UniProt Synonym Gene Names: LDLP
• UniProt Entry Name: LPXN_HUMAN

Uniprot Description

leupaxin: a LIM domain-containing cytoplasmic protein preferentially expressed in hematopoietic cells. Homologous to the focal adhesion protein, paxillin. Associates with PYK2, a member of focal adhesion kinase family, it may participate in signaling at sites of adhesion. .

Protein type: Motility/polarity/chemotaxis; Adaptor/scaffold; Cytoskeletal

Chromosomal Location of Human Ortholog: 11q12.1

Cellular Component: focal adhesion; cell projection; membrane; perinuclear region of cytoplasm; cytoplasm; plasma membrane; podosome; nucleus

Molecular Function: protein binding; zinc ion binding; transcription cofactor activity

Biological Process: regulation of cell adhesion mediated by integrin; regulation of transcription, DNA-dependent; transcription, DNA-dependent; negative regulation of B cell receptor signaling pathway; protein complex assembly; negative regulation of cell adhesion; signal transduction; cell adhesion