Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ELP4Sample Type: Fetal Heart lysatesAntibody Dilution: 1.0ug/ml)

Rabbit ELP4 Polyclonal Antibody | anti-ELP4 antibody

ELP4 Antibody - C-terminal region

Gene Names
ELP4; AN; AN2; hELP4; PAXNEB; PAX6NEB; C11orf19; dJ68P15A.1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ELP4; Polyclonal Antibody; ELP4 Antibody - C-terminal region; anti-ELP4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TMPTHLIQNKAIIARVTTLSDVVVGLESFIGSERETNPLYKDYHGLIHIR
Sequence Length
535
Applicable Applications for anti-ELP4 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human ELP4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ELP4Sample Type: Fetal Heart lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ELP4Sample Type: Fetal Heart lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ELP4 antibody
This is a rabbit polyclonal antibody against ELP4. It was validated on Western Blot

Target Description: This gene encodes a component of the six subunit elongator complex, a histone acetyltransferase complex that associates directly with RNA polymerase II during transcriptional elongation. The human gene can partially complement sensitivity phenotypes of yeast ELP4 deletion mutants. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined.
Product Categories/Family for anti-ELP4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
elongator complex protein 4 isoform 2
NCBI Official Synonym Full Names
elongator acetyltransferase complex subunit 4
NCBI Official Symbol
ELP4
NCBI Official Synonym Symbols
AN; AN2; hELP4; PAXNEB; PAX6NEB; C11orf19; dJ68P15A.1
NCBI Protein Information
elongator complex protein 4
UniProt Protein Name
Elongator complex protein 4
Protein Family
UniProt Gene Name
ELP4
UniProt Synonym Gene Names
C11orf19; PAXNEB; hELP4
UniProt Entry Name
ELP4_HUMAN

NCBI Description

This gene encodes a component of the six subunit elongator complex, a histone acetyltransferase complex that associates directly with RNA polymerase II during transcriptional elongation. The human gene can partially complement sensitivity phenotypes of yeast ELP4 deletion mutants. This gene has also been associated with Rolandic epilepsy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2013]

Uniprot Description

ELP4: Acts as subunit of the RNA polymerase II elongator complex, which is a histone acetyltransferase component of the RNA polymerase II (Pol II) holoenzyme and is involved in transcriptional elongation. Elongator may play a role in chromatin remodeling and is involved in acetylation of histones H3 and probably H4. Belongs to the ELP4 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Unknown function

Chromosomal Location of Human Ortholog: 11p13

Cellular Component: cytoplasm; Elongator holoenzyme complex; histone acetyltransferase complex; nucleoplasm; transcription elongation factor complex

Molecular Function: histone acetyltransferase activity; phosphorylase kinase regulator activity; protein binding

Biological Process: regulation of transcription from RNA polymerase II promoter; RNA elongation from RNA polymerase II promoter

Disease: Aniridia; Aniridia 2

Research Articles on ELP4

Similar Products

Product Notes

The ELP4 elp4 (Catalog #AAA3212183) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ELP4 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ELP4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ELP4 elp4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TMPTHLIQNK AIIARVTTLS DVVVGLESFI GSERETNPLY KDYHGLIHIR. It is sometimes possible for the material contained within the vial of "ELP4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.