Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: LPPSample Tissue: Mouse Lung lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse LPP Polyclonal Antibody | anti-LPP antibody

LPP Antibody - N-terminal region

Gene Names
Lpp; C79715; AA959454; AU024130; D630048H16; 9430020K16Rik; B130055L10Rik
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
LPP; Polyclonal Antibody; LPP Antibody - N-terminal region; anti-LPP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FGNPSISVSTQQPPKKYAPVVAPKPKYNPYKQPGGEGDLLPPPPPPLEDP
Sequence Length
613
Applicable Applications for anti-LPP antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of mouse LPP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: LPPSample Tissue: Mouse Lung lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: LPPSample Tissue: Mouse Lung lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-LPP antibody
May play a structural role at sites of cell adhesion in maintaining cell shape and motility. In addition to these structural functions, it may also be implicated in signaling events and activation of gene transcription. May be involved in signal transduction from cell adhesion sites to the nucleus allowing successful integration of signals arising from soluble factors and cell-cell adhesion sites. Also suggested to serve as a scaffold protein upon which distinct protein complexes are assembled in the cytoplasm and in the nucleus (By similarity).
Product Categories/Family for anti-LPP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67 kDa
NCBI Official Full Name
lipoma-preferred partner homolog isoform 1
NCBI Official Synonym Full Names
LIM domain containing preferred translocation partner in lipoma
NCBI Official Symbol
Lpp
NCBI Official Synonym Symbols
C79715; AA959454; AU024130; D630048H16; 9430020K16Rik; B130055L10Rik
NCBI Protein Information
lipoma-preferred partner homolog
UniProt Protein Name
Lipoma-preferred partner homolog
Protein Family
UniProt Gene Name
Lpp
UniProt Entry Name
LPP_MOUSE

Research Articles on LPP

Similar Products

Product Notes

The LPP lpp (Catalog #AAA3223611) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LPP Antibody - N-terminal region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's LPP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LPP lpp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FGNPSISVST QQPPKKYAPV VAPKPKYNPY KQPGGEGDLL PPPPPPLEDP. It is sometimes possible for the material contained within the vial of "LPP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.