Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- LIMK1 Picoband antibody, MBS177701, Western blottingAll lanes: Anti LIMK1 (MBS177701) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Gaster Tissue Lysate at 50ugLane 3: HELA Whole Cell Lysate at 40ugLane 4: U87 Whole Cell Lysate at 40ugLane 5: SKOV Whole Cell Lysate at 40ugPredicted bind size: 72KDObserved bind size: 72KD )

LIMK1 Polyclonal Antibody | anti-LIMK1 antibody

Anti-LIMK1 Antibody

Gene Names
LIMK1; LIMK; LIMK-1
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
LIMK1; Polyclonal Antibody; Anti-LIMK1 Antibody; LIM domain kinase 1; EC 2.7.11.1; LIM motif-containing protein kinase; LIMK; LIMK-1; limk1; LIMK1_HUMAN; anti-LIMK1 antibody
Ordering
For Research Use Only!
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
613
Applicable Applications for anti-LIMK1 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human LIMK1 (599-634aa KLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRR), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- LIMK1 Picoband antibody, MBS177701, Western blottingAll lanes: Anti LIMK1 (MBS177701) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Gaster Tissue Lysate at 50ugLane 3: HELA Whole Cell Lysate at 40ugLane 4: U87 Whole Cell Lysate at 40ugLane 5: SKOV Whole Cell Lysate at 40ugPredicted bind size: 72KDObserved bind size: 72KD )

Western Blot (WB) (Anti- LIMK1 Picoband antibody, MBS177701, Western blottingAll lanes: Anti LIMK1 (MBS177701) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Gaster Tissue Lysate at 50ugLane 3: HELA Whole Cell Lysate at 40ugLane 4: U87 Whole Cell Lysate at 40ugLane 5: SKOV Whole Cell Lysate at 40ugPredicted bind size: 72KDObserved bind size: 72KD )
Related Product Information for anti-LIMK1 antibody
Description: Rabbit IgG polyclonal antibody for LIM domain kinase 1(LIMK1) detection. Tested with WB in Human;Mouse;Rat.

Background: LIM domain kinase 1 is an enzyme that in humans is encoded by the LIMK1 gene. There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs, a central PDZ domain, and a C-terminal protein kinase domain. LIMK1 is likely to be a component of an intracellular signaling pathway and may be involved in brain development.
References
1. "Entrez Gene: LIMK1 LIM domain kinase 1". 2. Osborne LR, Martindale D, Scherer SW, Shi XM, Huizenga J, Heng HH, Costa T, Pober B, Lew L, Brinkman J, Rommens J, Koop B, Tsui LC (Jan 1997). "Identification of genes from a 500-kb region at 7q11.23 that is commonly deleted in Williams syndrome patients". Genomics 36 (2): 328-36. 3. Tassabehji M, Metcalfe K, Fergusson WD, Carette MJ, Dore JK, Donnai D, Read AP, Pröschel C, Gutowski NJ, Mao X, Sheer D (Aug 1996). "LIM-kinase deleted in Williams syndrome". Nat. Genet. 13 (3): 272-3.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68,729 Da
NCBI Official Full Name
LIM domain kinase 1 isoform 2
NCBI Official Synonym Full Names
LIM domain kinase 1
NCBI Official Symbol
LIMK1
NCBI Official Synonym Symbols
LIMK; LIMK-1
NCBI Protein Information
LIM domain kinase 1
UniProt Protein Name
LIM domain kinase 1
Protein Family
UniProt Gene Name
LIMK1
UniProt Synonym Gene Names
LIMK; LIMK-1
UniProt Entry Name
LIMK1_HUMAN

NCBI Description

There are approximately 40 known eukaryotic LIM proteins, so named for the LIM domains they contain. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs and a C-terminal protein kinase domain. LIMK1 is a serine/threonine kinase that regulates actin polymerization via phosphorylation and inactivation of the actin binding factor cofilin. This protein is ubiquitously expressed during development and plays a role in many cellular processes associated with cytoskeletal structure. This protein also stimulates axon growth and may play a role in brain development. LIMK1 hemizygosity is implicated in the impaired visuospatial constructive cognition of Williams syndrome. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Feb 2011]

Uniprot Description

LIMK1: a TKL kinase of the LISK family which mediates Rho signaling to cytoskeleton. Contains two N-terminal LIM motifs. Phosphorylated and activated by PAK1 and ROCK, downstream effectors of Rho. May be involved in brain development. Phosphorylates and inactivates the actin binding/depolymerizing factor cofilin and induces actin cytoskeletal changes. The LIM domain interacts with the cytoplasmic domain of NRG1. Binds ROCK1. Interacts with slingshot 1. Overexpressed in prostate tumors and prostate and breast cancer cell lines; manipulation of activity correlates with invasiveness in breast and prostate cancer models. Located within the 7q11.2 amplicon associated with metastatic prostate cancer. Loss of one copy of LIMK1 is the likely cause of visuospatial cognition defects seen in small chromosomal deletions associated with dominant Williams-Beuren syndrome Three splice variant have been identified.

Protein type: EC 2.7.11.1; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; Protein kinase, TKL; TKL group; LISK family; LIMK subfamily

Chromosomal Location of Human Ortholog: 7q11.23

Cellular Component: cytoplasm; cytosol; focal adhesion; Golgi apparatus; membrane; neuron projection; nucleoplasm; perinuclear region of cytoplasm

Molecular Function: ATP binding; heat shock protein binding; protein binding; protein heterodimerization activity; protein kinase activity; protein serine/threonine kinase activity; zinc ion binding

Biological Process: actin cytoskeleton organization and biogenesis; negative regulation of ubiquitin-protein ligase activity; nervous system development; positive regulation of actin filament bundle formation; positive regulation of axon extension; positive regulation of stress fiber formation; protein amino acid phosphorylation; Rho protein signal transduction; signal transduction

Disease: Williams-beuren Syndrome

Research Articles on LIMK1

Similar Products

Product Notes

The LIMK1 limk1 (Catalog #AAA177701) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-LIMK1 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LIMK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the LIMK1 limk1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LIMK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.