Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-LGSN AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

Rabbit LGSN Polyclonal Antibody | anti-LGSN antibody

LGSN Antibody - N-terminal region

Gene Names
LGSN; LGS; GLULD1
Reactivity
Cow, Dog, Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LGSN; Polyclonal Antibody; LGSN Antibody - N-terminal region; anti-LGSN antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QEDSTRDEGNETEANSMNTLRRTRKKVTKPYVCSTEVGETDMSNSNDCMR
Sequence Length
509
Applicable Applications for anti-LGSN antibody
Western Blot (WB)
Homology
Cow: 85%; Dog: 100%; Human: 100%; Rabbit: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human LGSN
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-LGSN AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

Western Blot (WB) (WB Suggested Anti-LGSN AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)
Related Product Information for anti-LGSN antibody
This is a rabbit polyclonal antibody against LGSN. It was validated on Western Blot

Target Description: This gene encodes a protein with similarity to the GS I members of the glutamine synthetase superfamily. The encoded protein is referred to as a pseudo-glutamine synthetase because it has no glutamine synthesis activity and may function as a chaperone protein. This protein is localized to the lens and may be associated with cataract disease.
Product Categories/Family for anti-LGSN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
lengsin isoform a
NCBI Official Synonym Full Names
lengsin, lens protein with glutamine synthetase domain
NCBI Official Symbol
LGSN
NCBI Official Synonym Symbols
LGS; GLULD1
NCBI Protein Information
lengsin
UniProt Protein Name
Lengsin
Protein Family
UniProt Gene Name
LGSN
UniProt Synonym Gene Names
GLULD1; LGS
UniProt Entry Name
LGSN_HUMAN

NCBI Description

This gene encodes a protein with similarity to the GS I members of the glutamine synthetase superfamily. The encoded protein is referred to as a pseudo-glutamine synthetase because it has no glutamine synthesis activity and may function as a chaperone protein. This protein is localized to the lens and may be associated with cataract disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2009]

Research Articles on LGSN

Similar Products

Product Notes

The LGSN lgsn (Catalog #AAA3216950) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LGSN Antibody - N-terminal region reacts with Cow, Dog, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's LGSN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LGSN lgsn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QEDSTRDEGN ETEANSMNTL RRTRKKVTKP YVCSTEVGET DMSNSNDCMR. It is sometimes possible for the material contained within the vial of "LGSN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.